Rabbit EXOC3 antibody
-
Catalog number70R-2856
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaCell Biology
-
ImmunogenEXOC3 antibody was raised using the middle region of EXOC3 corresponding to a region with amino acids LERTVTTRIEGTQADTRESDKMWLVRHLEIIRKYVLDDLIVAKNLMVQCF
-
SpecificityEXOC3 antibody was raised against the middle region of EXOC3
-
Cross ReactivityHuman,Mouse,Rat
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of EXOC3 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolEXOC3, EXOC3-AS1
-
Short nameRabbit EXOC3 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal EXOC3 antibody raised against the middle region of EXOC3
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetexocyst complex component 3, SEC6 and SEC6L1 and Sec6p, EXOC3 and IDBG-10290 and ENSG00000180104 and 11336, protein binding, Cytoplasm, Exoc3 and IDBG-167158 and ENSMUSG00000034152 and 211446, EXOC3 and IDBG-632568 and ENSBTAG00000008606 and 513138
-
Gene info
-
Identity
-
Gene
-
Long gene nameexocyst complex component 3
-
Synonyms gene
-
Synonyms gene name
- SEC6-like 1 (S. cerevisiae)
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year2004-01-08
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Exocyst complex
-
VEGA ID
Gene info
-
Identity
-
Gene
-
Long gene nameEXOC3 antisense RNA 1
-
Synonyms gene
-
Synonyms gene name
- chromosome 5 open reading frame 55
-
GenBank acession
-
Locus
-
Discovery year2009-04-06
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Antisense RNAs
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data