DVL1 Antibody
#
-
Catalog numberA03533-1
-
Price:
-
Size0,1 mg
-
-
Target antigenDVL1
-
ClonalityPolyclonal antibody
-
ClonePolyclonal antibody
-
Raised inrabbit
-
Type of the antibodyIgG polyclonal antibody
-
Product formfreeze-dried
-
Reacts with specieshuman, mouse, rat
-
AnalysesWB,IHC-P
-
ImmunogenA synthetic peptide corresponding to a sequence in the middle region of human DVL1 (401-438aa APQLEEAPLTVKSDMSAVVRVMQLPDSGLEIRDRMWLK), different from the related mouse and rat sequences by one amino acid.
-
Product configurationEach vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
-
PurificationImmunogen affinity purified.
-
SolubilizationThe powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
-
Storage condtionsKeep the DVL1 Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
-
TipsThe DVL1 Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
-
BackgroundSegment polarity protein dishevelled homolog DVL-1 is a protein that in humans is encoded by the DVL1 gene. DVL1, the human homolog of the Drosophila dishevelled gene (dsh) encodes a cytoplasmic phosphoprotein that regulates cell proliferation, acting as a transducer molecule for developmental processes, including segmentation and neuroblast specification. DVL1 is a candidate gene for neuroblastomatous transformation. The Schwartz-Jampel syndrome and Charcot-Marie-Tooth disease type 2A have been mapped to the same region as DVL1. The phenotypes of these diseases may be consistent with defects which might be expected from aberrant expression of a DVL gene during development.
-
Related articles1. Li L, Yuan H, Weaver CD, Mao J, Farr GH, Sussman DJ, Jonkers J, Kimelman D, Wu D (Aug 1999). "Axin and Frat1 interact with dvl and GSK, bridging Dvl to GSK in Wnt-mediated regulation of LEF-1". EMBO J. 18 (15): 4233–40. 2. Pizzuti A, Amati F, Calabrese G, Mari A, Colosimo A, Silani V, Giardino L, Ratti A, Penso D, Calzà L, Palka G, Scarlato G, Novelli G, Dallapiccola B (Jan 1997). "cDNA characterization and chromosomal mapping of two human homologues of the Drosophila dishevelled polarity gene". Hum Mol Genet. 5 (7): 953–8.
-
Gene NameDVL1
-
Protein NameSegment polarity protein dishevelled homolog DVL-1
-
Gene Full Namedishevelled segment polarity protein 1
-
SynonymsDishevelled 1 | Dishevelled | Dishevelled-1 | Dishevelled1 | DSH homolog 1 | Dvl 1 | Dvl | Dvl1 | DVL1L1 | DVL1P1 | DRS2 | O14640
-
Uniprot IDO14640
-
Entrez GeneID1855
-
PropertiesIf you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
French translationanticorps
-
Gene target
-
Gene symbolDVL1
-
Short nameDVL1 Antibody
-
TechniqueAntibody, antibodies against human proteins, antibodies for
-
Alternative nameDVL1 (antibody to-)
-
Alternative techniqueantibodies
-
Gene info
-
Identity
-
Gene
-
Long gene namedishevelled segment polarity protein 1
-
Synonyms gene name
- dishevelled 1 (homologous to Drosophila dsh)
- dishevelled, dsh homolog 1 (Drosophila)
-
GenBank acession
-
Locus
-
Discovery year1996-03-12
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- PDZ domain containing
- Dishevelled segment polarity proteins
- MicroRNA protein coding host genes
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data