DVL1 Antibody

#
  • Catalog number
    A03533-1
  • Price:

    Please ask

    Ask for price
  • Size
    0,1 mg
# #
  • Target antigen
    DVL1
  • Clonality
    Polyclonal antibody
  • Clone
    Polyclonal antibody
  • Raised in
    rabbit
  • Type of the antibody
    IgG polyclonal antibody
  • Product form
    freeze-dried
  • Reacts with species
    human, mouse, rat
  • Analyses
    WB,IHC-P
  • Immunogen
    A synthetic peptide corresponding to a sequence in the middle region of human DVL1 (401-438aa APQLEEAPLTVKSDMSAVVRVMQLPDSGLEIRDRMWLK), different from the related mouse and rat sequences by one amino acid.
  • Product configuration
    Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
  • Purification
    Immunogen affinity purified.
  • Solubilization
    The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
  • Storage condtions
    Keep the DVL1 Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
  • Tips
    The DVL1 Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
  • Background
    Segment polarity protein dishevelled homolog DVL-1 is a protein that in humans is encoded by the DVL1 gene. DVL1, the human homolog of the Drosophila dishevelled gene (dsh) encodes a cytoplasmic phosphoprotein that regulates cell proliferation, acting as a transducer molecule for developmental processes, including segmentation and neuroblast specification. DVL1 is a candidate gene for neuroblastomatous transformation. The Schwartz-Jampel syndrome and Charcot-Marie-Tooth disease type 2A have been mapped to the same region as DVL1. The phenotypes of these diseases may be consistent with defects which might be expected from aberrant expression of a DVL gene during development.
  • Related articles
    1. Li L, Yuan H, Weaver CD, Mao J, Farr GH, Sussman DJ, Jonkers J, Kimelman D, Wu D (Aug 1999). "Axin and Frat1 interact with dvl and GSK, bridging Dvl to GSK in Wnt-mediated regulation of LEF-1". EMBO J. 18 (15): 4233–40. 2. Pizzuti A, Amati F, Calabrese G, Mari A, Colosimo A, Silani V, Giardino L, Ratti A, Penso D, Calzà L, Palka G, Scarlato G, Novelli G, Dallapiccola B (Jan 1997). "cDNA characterization and chromosomal mapping of two human homologues of the Drosophila dishevelled polarity gene". Hum Mol Genet. 5 (7): 953–8.
  • Gene Name
    DVL1
  • Protein Name
    Segment polarity protein dishevelled homolog DVL-1
  • Gene Full Name
    dishevelled segment polarity protein 1
  • Synonyms
    Dishevelled 1 | Dishevelled | Dishevelled-1 | Dishevelled1 | DSH homolog 1 | Dvl 1 | Dvl | Dvl1 | DVL1L1 | DVL1P1 | DRS2 | O14640
  • Uniprot ID
    O14640
  • Entrez GeneID
    1855
  • Properties
    If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
  • French translation
    anticorps
#
  • Gene target
    DVL1  
  • Gene symbol
    DVL1
  • Short name
    DVL1 Antibody
  • Technique
    Antibody, antibodies against human proteins, antibodies for
  • Alternative name
    DVL1 (antibody to-)
  • Alternative technique
    antibodies
Gene info
  • Identity
  • Gene
  • Long gene name
    dishevelled segment polarity protein 1
  • Synonyms gene name
    • dishevelled 1 (homologous to Drosophila dsh)
    • dishevelled, dsh homolog 1 (Drosophila)
  • GenBank acession
  • Locus
  • Discovery year
    1996-03-12
  • Entrez gene record
  • Pubmed identfication
  • RefSeq identity
  • Classification
    • PDZ domain containing
    • Dishevelled segment polarity proteins
    • MicroRNA protein coding host genes
  • VEGA ID
MeSH Data
  • Name
  • Concept
    Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
  • Tree numbers
    • E05.196.401.143
    • E05.301.300.096
    • E05.478.566.320.200
    • E05.601.262
    • E05.601.470.320.200
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee