DIDO1 Blocking Peptide

• Catalog number
  33R-2714
• Price
  Please ask
• Size
  100 µg

• Category
  Proteins
• Antibody Subtype
  Blocking Peptides
• Area of research
  Signal Transduction
• Residues
  ERVEQFLTIARRRGRRSMPVSLEDSGEPTSCPATDAETASEGSVESASET
• Type of protein
  Synthetic
• Form Buffer
  Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.
• Storage
  Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.
• Shipping conditions
  Blue Ice
• Tested for
  WB; IHC
• URL
• More info
• Test
  You can block the antibody by the specific target amino acid sequence of peptide.
• Properties
  blocking peptide
• Description
  Peptides short amino acid chains or epitopes or blocking antagonists. The shortest peptides are dipeptides, consisting of 2 amino acids joined by a single peptide bond, followed by tripeptides, tetra peptides, ... till polypeptides that are long, continuous, and unbranched synthetic peptide chains. These biological oligomers and polymers can be Solid-phase peptide synthesis (SPPS), or in continue produced for custom peptide synthesis projects. The High-efficiency solid phase peptide synthesis (HE-SPPS) is give very low production costs.

• Gene target
  DIDO1  
• Gene symbol
  DIDO1
• Short name
  DIDO1 Blocking Peptide
• Technique
  blocking peptide, Blocking, peptide, blocking peptides, fitzgerald made this blocking amino acid sequence or peptide to block the gene target in a volume of 1. For western blot it is often requested to block your antibody and to see the band of the analyzed protein disappear. This is called a negative control by blocking the WB antibody. peptides
• Alternative name
  A synthetic peptide for use as a blocking control in assays to test for specificity of DIDO1 antibody, catalog no. 70R-8059
• Alternative technique
  control, peptides
• Alternative to gene target
  death inducer-obliterator 1, BYE1 and C20orf158 and DATF-1 and DATF1 and DIDO2 and DIDO3 and DIO-1 and DIO1 and dJ885L7.8, DIDO1 and IDBG-85596 and ENSG00000101191 and 11083, poly(A) RNA binding, nuclei, Dido1 and IDBG-213878 and ENSMUSG00000038914 and 23856, DIDO1 and IDBG-640734 and ENSBTAG00000006002 and 519826

Gene info

• Identity
  HGNC:2680
• Gene
  DIDO1
• Long gene name
  death inducer-obliterator 1
• Synonyms gene
  • C20orf158
  • DATF1
• Synonyms gene name
  • chromosome 20 open reading frame 158
  • death associated transcription factor 1
• Synonyms
  • DIO1
  • dJ885L7.8
  • FLJ11265
  • KIAA0333
  • DIO-1
  • BYE1
• GenBank acession
  • AB002331
• Locus
  20q13.33
• Discovery year
  1999-12-17
• Entrez gene record
  11083
• Pubmed identfication
  • 10393935
• RefSeq identity
  • NM_080796
• Classification
  • PHD finger proteins
• VEGA ID
  OTTHUMG00000032945

Similar products