Calsyntenin 3 antibody

Calsyntenin 3 antibody is available 1 time from Fitzgerald labs

  • Category
    Primary Antibody
  • Tested for
    WB
  • Raised in
    Rabbit
  • Antibody Subtype
    Polyclonal Antibodies, Purified
  • Method of Purification
    Affinity purified
  • Specificity
    Calsyntenin 3 antibody was raised against the N terminal of CLSTN3
  • Additional Information
    This is a rabbit polyclonal antibody against CLSTN3, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at antibodies@fitzgerald-fii.com
  • Shipping conditions
    Blue Ice
  • Assay Information
    Calsyntenin 3 Blocking Peptide, catalog no. 33R-7585, is also available for use as a blocking control in assays to test for specificity of this Calsyntenin 3 antibody
  • Concentration
    1 mg/ml
  • Form & Buffer
    Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CLSTN3 antibody in PBS
  • Storage
    Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
  • Usage Recommendations
    WB: 1 ug/ml
  • Type of Immunogen
    Calsyntenin 3 antibodies were raised using the N terminal of CLSTN3 corresponding to a region with amino acids QICYYEILTPNTPFLIDNDGNIENTEKLQYSGERLYKFTVTAYDCGKKRA
  • Area of research
    Neuroscience
  • Cross Reactivity
    Human
  • Gene target
  • Short name
    Calsyntenin 3 antibody
  • Technique
    Antibody
  • Alternative name
    Calsyntenin 3 (Antibody to)
  • Alternative technique
    antibodies

70R-6618 | Calsyntenin 3 antibodysize: 50 µg | 584.2 USD

Ajax processing
Simillar products
Supplier:genways
Price:640.78USD
Supplier:trca
Price:6 928.03USD
Supplier:aviva
Price:521.48USD
Supplier:fitzgerald
Price:478.43USD
Supplier:Ape
Price:275.99USD
Supplier:Epigen
Price:394.80USD
Supplier:SFC
Price:0.00USD
Supplier:abbex
Price:1 403.32USD
Supplier:genways
Price:640.78USD
Supplier:ABM microrna
Price:2 676.26USD
Supplier:StressMarq
Price:122.99USD
Supplier:abebio
Price:825.51USD
Supplier:BlueGen ELISAs
Price:744.09USD
Supplier:MBS Polyclonals
Price:373.89USD
Supplier:SFC
Price:0.00USD
Supplier:proscience
Price:839.41USD
Filters
+32-(0)1-658-90-45 lieven@gentaur.com
Calsyntenin 3 antibody - Gentaur.com
Contact
Chat with gentaur.com employee