DR4 Antibody

• Catalog number
  A02152
• Price
  Please ask
• Size
  0,1 mg

• Target antigen
  DR4
• Clonality
  Polyclonal antibody
• Clone
  Polyclonal antibody
• Raised in
  rabbit
• Type of the antibody
  IgG polyclonal antibody
• Product form
  freeze-dried
• Reacts with species
  human
• Analyses
  WB
• Immunogen
  A synthetic peptide corresponding to a sequence at the N-terminus of human DR4 (99-131aa VLLQVVPSSAATIKLHDQSIGTQQWEHSPLGEL).
• Product configuration
  Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Purification
  Immunogen affinity purified.
• Solubilization
  The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
• Storage condtions
  Keep the DR4 Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
• Tips
  The DR4 Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
• Background
  TNFRSF10A (Tumor Necrosis Factor Receptor Subfamily Member 10A), also known as APO2, DR4 or TRAILR1, is a protein that in humans is encoded by the TNFRSF10A gene. The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is activated by tumor necrosis factor-related apoptosis inducing ligand (TNFSF10/TRAIL), and thus transduces cell death signal and induces cell apoptosis. Studies with FADD-deficient mice suggested that FADD, a death domain containing adaptor protein, is required for the apoptosis mediated by this protein.
• Related articles
  1. Walczak H, Degli-Esposti MA, Johnson RS, Smolak PJ, Waugh JY, Boiani N, Timour MS, Gerhart MJ, Schooley KA, Smith CA, Goodwin RG, Rauch CT (Dec 1997). "TRAIL-R2: a novel apoptosis-mediating receptor for TRAIL". EMBO J. 16 (17): 5386–97. 2. Pan G, O'Rourke K, Chinnaiyan AM, Gentz R, Ebner R, Ni J, Dixit VM (April 1997). "The receptor for the cytotoxic ligand TRAIL". Science. 276 (5309): 111–3.
• Gene Name
  TNFRSF10A
• Protein Name
  Tumor necrosis factor receptor superfamily member 10A
• Gene Full Name
  TNF receptor superfamily member 10a
• Synonyms
  APO2 | DR4 | TRAILR1 | CD261 antigen | DR4 | TNFRSF10A | TR10A | TRAIL R1 | TRAIL-R1 | O00220
• Uniprot ID
  O00220
• Entrez GeneID
  8797
• Properties
  If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  DR4  
• Gene symbol
  TNFRSF10A
• Short name
  DR4 Antibody
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Alternative name
  DR4 (antibody to-)
• Alternative technique
  antibodies

Gene info

• Identity
  HGNC:11904
• Gene
  TNFRSF10A
• Long gene name
  TNF receptor superfamily member 10a
• Synonyms gene name
  • tumor necrosis factor receptor superfamily, member 10a
• Synonyms
  • DR4
  • Apo2
  • TRAILR-1
  • CD261
  • TRAILR1
• GenBank acession
  • U90875
• Locus
  8p21.3
• Discovery year
  1998-12-04
• Entrez gene record
  8797
• Pubmed identfication
  • 9311998
  • 9082980
• RefSeq identity
  • NM_003844
• Classification
  • CD molecules
  • Tumor necrosis factor receptor superfamily
• VEGA ID
  OTTHUMG00000097843

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products