Anti-CXCR4 Picoband Antibody

Anti-CXCR4 Picoband Antibody is available 1 time from Boster labs

  • Clonality
    Polyclonal
  • Sample Size Available
    30ug for $99, contact us for details
  • Immunogen
    A synthetic peptide corresponding to a sequence at the C-terminus of human CXCR4 (265-294aa ILLEIIKQGCEFENTVHKWISITEALAFFH), different from the related mouse sequence by five amino acids, and from the related rat sequence by three amino acids.
  • Form
    Lyophilized
  • Purification
    Immunogen affinity purified.
  • Storage & Transport Conditions
    At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid repeated freezing and thawing.
  • Cross-reactivity
    No cross reactivity with other proteins.
  • Ig Type
    N/A
  • Reconstitution
    Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
  • Application Details
    Western blot, 0.1-0.5µg/ml, Human
  • Applications
    WB
  • Reactivity
    Human
  • Product Datasheet
    www.bosterbio.com/datasheet.php?sku=A00031
  • Description
    This antibody needs to be stored at + 4°C in a fridge short term in a concentrated dilution. Freeze thaw will destroy a percentage in every cycle and should be avoided.
  • Properties
    If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
  • French translation
    anticorps
  • Gene target
  • Short name
    Anti-CXCR4 Picoband Antibody
  • Technique
    Antibody, anti
  • Alternative name
    antibody to-chemokine (C-X-C motif) receptor 4 Picoband (Antibody to)
  • Alternative technique
    antibodies
  • Alternative to gene target
    chemokine (C-X-C motif) receptor 4, CD184 and D2S201E and FB22 and HM89 and HSY3RR and LAP-3 and LAP3 and LCR1 and LESTR and NPY3R and NPYR and NPYRL and NPYY3R and WHIM, CXCR4 and IDBG-71032 and ENSG00000121966 and 7852, this GO :0000187 and activation of MAPK activity and biological process this GO :0001569 and patterning of blood vessels and biological process this GO :0001618 and virus receptor activity and molecular function this GO :0001666 and response to hypoxia and biological process this GO :0001667 and ameboidal cell migration and biological process this GO :0001764 and neuron migration and biological process this GO :0002407 and dendritic cell chemotaxis and biological process this GO :0003779 and actin binding and molecular function this GO :0004930 and G-protein coupled receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005737 and cytoplasm and cellular component this GO :0005764 and lysosome and cellular component this GO :0005769 and early endosome and cellular component this GO :0005770 and late endosome and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0005911 and cell-cell junction and cellular component this GO :0006915 and apoptotic process and biological process this GO :0006954 and inflammatory response and biological process this GO :0007186 and G-protein coupled receptor signaling pathway and biological process this GO :0007204 and positive regulation of cytosolic calcium ion concentration and biological process this GO :0007281 and germ cell development and biological process this GO :0007420 and brain development and biological process this GO :0008045 and motor neuron axon guidance and biological process this GO :0008354 and germ cell migration and biological process this GO :0009615 and response to virus and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0009986 and cell surface and cellular component this GO :0015026 and coreceptor activity and molecular function this GO :0016021 and integral component of membrane and cellular component this GO :0016023 and cytoplasmic membrane-bounded vesicle and cellular component this GO :0016032 and viral process and biological process this GO :0016494 and C-X-C chemokine receptor activity and molecular function this GO :0019722 and calcium-mediated signaling and biological process this GO :0019955 and cytokine binding and molecular function this GO :0030054 and cell junction and cellular component this GO :0030260 and entry into host cell and biological process this GO :0030334 and regulation of cell migration and biological process this GO :0030426 and growth cone and cellular component this GO :0031252 and cell leading edge and cellular component this GO :0031410 and cytoplasmic vesicle and cellular component this GO :0031625 and ubiquitin protein ligase binding and molecular function this GO :0032027 and myosin light chain binding and molecular function this GO :0042098 and T cell proliferation and biological process this GO :0042119 and neutrophil activation and biological process this GO :0043130 and ubiquitin binding and molecular function this GO :0043217 and myelin maintenance and biological process this GO :0045087 and innate immune response and biological process this GO :0048699 and generation of neurons and biological process this GO :0048714 and positive regulation of oli this GO dendrocyte differentiation and biological process this GO :0050920 and regulation of chemotaxis and biological process this GO :0061351 and neural precursor cell proliferation and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0070098 and chemokine-mediated signaling pathway and biological process this GO :0071345 and cellular response to cytokine stimulus and biological process, ubiquitin binding, this GO :0001618: virus receptor activity and also this GO :0003779: actin binding and also this GO :0004930: G-protein coupled receptor activity and also this GO :0005515: protein binding and also this GO :0015026: coreceptor activity and also this GO :0016494: C-X-C chemokine receptor activity and also this GO :0019955: cytokine binding and also this GO :0031625: ubiquitin protein ligase binding and also this GO :0032027: myosin light chain binding and also this GO :0043130: ubiquitin binding, this GO :0001618: virus receptor activity, this GO :0003779: actin binding, this GO :0004930: G-protein coupled receptor activity, this GO :0005515: protein binding, this GO :0015026: coreceptor activity, this GO :0016494: C-X-C chemokine receptor activity, this GO :0019955: cytokine binding, this GO :0031625: ubiquitin protein ligase binding, this GO :0032027: myosin light chain binding, this GO :0043130: ubiquitin binding, Cell surfaces, Cxcr4 and IDBG-189999 and ENSMUSG00000045382 and 12767, CXCR4 and IDBG-642187 and ENSBTAG00000001060 and 281736

A00031 | Anti-CXCR4 Picoband Antibodysize: 100µg/vial | 480.05 USD

Ajax processing
Simillar products
Supplier:fitzgerald
Price:478.82USD
Supplier:Ape
Price:164.20USD
Supplier:SFC
Price:0.00USD
Supplier:trca
Price:329.88USD
Supplier:aviva
Price:521.90USD
Supplier:trca
Price:132.94USD
Supplier:fabgen
Price:268.58USD
Supplier:abebio
Price:508.36USD
Supplier:SFC
Price:0.00USD
Supplier:MBS Polyclonals
Price:483.74USD
Supplier:aviva
Price:521.90USD
Supplier:trca
Price:132.94USD
Supplier:EnoGene
Price:461.59USD
Supplier:MBS Recombinant
Price:1 755.26USD
Supplier:ABM microrna
Price:1 515.24USD
Filters
+32-(0)1-658-90-45 lieven@gentaur.com
Anti-CXCR4 Picoband Antibody - Gentaur.com
Contact
Chat with gentaur.com employee