Anti-CXCR4 Picoband Antibody

Anti-CXCR4 Picoband Antibody is available 1 time from Boster labs

A00031 | Anti-CXCR4 Picoband Antibodysize: 100µg/vial | 455.13 USD

Ajax processing
  • Clonality
  • Sample Size Available
    30ug for $99, contact us for details
  • Immunogen
    A synthetic peptide corresponding to a sequence at the C-terminus of human CXCR4 (265-294aa ILLEIIKQGCEFENTVHKWISITEALAFFH), different from the related mouse sequence by five amino acids, and from the related rat sequence by three amino acids.
  • Form
  • Purification
    Immunogen affinity purified.
  • Storage & Transport Conditions
    At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid repeated freezing and thawing.
  • Cross-reactivity
    No cross reactivity with other proteins.
  • Ig Type
  • Reconstitution
    Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
  • Application Details
    Western blot, 0.1-0.5µg/ml, Human
  • Applications
  • Reactivity
  • Product Datasheet
  • Description
    This antibody needs to be stored at + 4°C in a fridge short term in a concentrated dilution. Freeze thaw will destroy a percentage in every cycle and should be avoided.
  • Properties
    If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
  • French translation
  • Gene target
  • Short name
    Anti-CXCR4 Picoband Antibody
  • Technique
    Antibody, anti
  • Alternative name
    antibody to-chemokine (C-X-C motif) receptor 4 Picoband (Antibody to)
  • Alternative technique
  • Alternative to gene target
    chemokine (C-X-C motif) receptor 4, CD184 and D2S201E and FB22 and HM89 and HSY3RR and LAP-3 and LAP3 and LCR1 and LESTR and NPY3R and NPYR and NPYRL and NPYY3R and WHIM, CXCR4 and IDBG-71032 and ENSG00000121966 and 7852, ubiquitin binding, Cell surfaces, Cxcr4 and IDBG-189999 and ENSMUSG00000045382 and 12767, CXCR4 and IDBG-642187 and ENSBTAG00000001060 and 281736
Simillar products
Supplier:abm Adinovirus
Supplier:MBS Polyclonals
Anti-CXCR4 Picoband Antibody -
Chat with employee