ACTN3 Antibody

• Catalog number
  R32494
• Price
  Please ask
• Size
  0.1mg

• Category
  Antibody
• Concentration
  0.5mg/ml if reconstituted with 0.2ml sterile DI water
• Form
  Antigen affinity purified
• Conjugation
  Unconjugated
• Clone
  Polyclonal antibody
• Recognised antigen
  ACTN3
• Host animal
  Rabbit (Oryctolagus cuniculus)
• Clonality
  Polyclonal (rabbit origin)
• Species reactivity
  Human (Homo sapiens), Mouse (Mus musculus), Rat ; Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur.
• Tested applications
  WB, IHC-P
• Recommended dilutions
  Western blot: 0.5-1ug/ml,IHC (FFPE): 1-2ug/ml
• Added buffer
  Lyophilized from 1X Phosphate Buffered Saline (PBS) with 2.5% BSA and 0.025% sodium azide
• Intented use
  This ACTN3 antibodyis to be used only for research purposes and not for diagnostics..
• Uniprot
  Q08043
• Purity
  Antigen affinity
• Description
  Alpha-actinin-3, also known as alpha-actinin skeletal muscle isoform 3 or F-actin cross-linking protein, is a protein that in humans is encoded by the ACTN3 gene. This gene encodes a member of the alpha-actin binding protein gene family. The encoded protein is primarily expressed in skeletal muscle and functions as a structural component of sarcomeric Z line. This protein is involved in crosslinking actin containing thin filaments. An allelic polymorphism in this gene results in both coding and non-coding variants; the reference genome represents the coding allele. The non-functional allele of this gene is associated with elite athlete status.
• Immunogen
  Amino acids 574-617 (EADRERGAIMGIQGEIQKICQTYGLRPCSTNPYITLSPQDINTK from the human protein were used as the immunogen for the ACTN3 antibody.
• Storage
  After reconstitution, the ACTN3 antibody may be kept for up to one month refrigerated at +4 degrees C.For long-term, aliquot and store at -20 deg. Celcius or lower. Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity. Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized. Avoid repeated freezing and thawing.
• Localization
  Cytoplasmic
• Properties
  If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  ACTN3  
• Gene symbol
  ACTN3
• Short name
  Anti- ACTN3
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Isotype
  Rabbit IgG
• Alternative name
  Antibodies to ACTN3
• Alternative technique
  antibodies
• Alternative to gene target
  actinin, alpha 3 (gene/pseudogene), ACTN3 and IDBG-409425 and ENSG00000248746 and 89, actin filament binding, Cell surfaces, Actn3 and IDBG-130128 and ENSMUSG00000006457 and 11474, ACTN3 and IDBG-644440 and ENSBTAG00000022244 and 539375

Gene info

• Identity
  HGNC:165
• Gene
  ACTN3
• Long gene name
  actinin alpha 3
• Synonyms gene name
  • actinin, alpha 3
  • actinin alpha 3 (gene/pseudogene)
• GenBank acession
  • M86407
• Locus
  11q13.2
• Discovery year
  1991-07-16
• Entrez gene record
  89
• Pubmed identfication
  • 1339456
  • 17828264
• RefSeq identity
  • NM_001104
• Classification
  • Actinins
• VEGA ID
  OTTHUMG00000160815

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products