Recombinant S. cerevisiae TIM16

• Catalog number
  CR27-50
• Price
  Please ask
• Size
  50 ug

• Description
  Recombinant S. cerevisiae Mitochondrial Import Inner Membrane Translocase Subunit TIM16 is produced by our E.coli expression system and the target gene encoding Thr54-Ala119 is expressed.
• Species reactivity
  S. cerevisiae
• Origin
  Escherichia coli
• Peptide sequence
  MTLDESCKILNIEESKGDLNMDKINNRFNYLFEVNDKEKGGSFYLQSKVYRAAERLKWELAQREKNA
• Estimated molecular weight
  7,9 kDa
• Protein purity
  Greater than 95% as determined by reducing SDS-PAGE.
• Endotoxin level
  Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Shipping condition
  Ambient/Room Temperature
• Package form
  Lyophilized from a 0.2 µm filtered solution of 20mM Tris,300mM NaCl,pH8.0.
• Storage conditions
  Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
• Reconstitution conditions
  Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
• UniProt number
  P42949
• Other related products
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  cerevisiae   TIM16  
• Gene symbol
  PAM16
• Short name
  Recombinant S. cerevisiae TIM16
• Technique
  Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Alternative name
  Recombinant S. cerevisiae TIM16
• Alternative technique
  rec

Gene info

• Identity
  HGNC:29679
• Gene
  PAM16
• Long gene name
  presequence translocase associated motor 16
• Synonyms gene name
  • presequence translocase-associated motor 16 homolog (S. cerevisiae)
  • presequence translocase associated motor 16 homolog
• Synonyms
  • Magmas
  • Tim16
  • TIMM16
• Synonyms name
  • mitochondria associated protein involved in granulocyte macrophage colony stimulating factor signal transduction
• GenBank acession
  • AK026514
• Locus
  16p13.3
• Discovery year
  2010-09-01
• Entrez gene record
  51025
• Pubmed identfication
  • 10810093
  • 11750097
  • 20053669
• RefSeq identity
  • NM_016069
• Classification
  • TIM23 complex
• VEGA ID
  OTTHUMG00000129466

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products