Recombinant Rat Interleukin-12/IL-12 (C-6His)

  • Catalog number
    CS66-1000
  • Price
    Please ask
  • Size
    1 mg
  • Description
    Recombinant Rat Interleukin-12 is produced by our Mammalian expression system and the target gene encoding Met23-Ser335(p40)&Arg23-Ser215(p35) is expressed with a 6His tag at the C-terminus.
  • Species reactivity
    Rat
  • Origin
    Human Cells
  • Peptide sequence
    MWELEKDVYVVEVDWRPDAPGETVTLTCDSPEEDDITWTSDQRRGVIGSGKTLTITVREFLDAGQYTCHRGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVHRNTDLKFNIKSSSSSPESRAVTCGRASLSAEKVTLNQRDYEKYSVACQEDVTCPTAEETLPIELVVEAQQQNKYENYSTSFFIRDIIKPDPPKNLQVKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKTKETEEECNQKGAFLVEKTSAEVQCKGANICVQAQDRYYNSSCSKWTCVPCRGRSHHHHHH&RVIPVSGPAKCLNQSQNLLKTTDDMVRTAREKLKHYSCTAGDIDHEDITRDKTSTLEACLPLELHKNESCLATKETSSIIRGSCLPPQKTSLMMTLCLGSIYEDLKMYQSEFQAINAALQSHNHQQITLDRNMLMAIDELMRSLNHSGETLHQKAPMGEADPYRVKMKLCILLHAFSTRVMTINRVMNYLSSSHHHHHH
  • Estimated molecular weight
    36,7 kDa&22,6 kDa
  • Protein purity
    Greater than 95% as determined by reducing SDS-PAGE.
  • Endotoxin level
    Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
  • Shipping condition
    Ambient/Room Temperature
  • Package form
    Lyophilized from a 0.2 µm filtered solution of PBS, pH7.4.
  • Storage conditions
    Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at below -20°C for 3 months.
  • Reconstitution conditions
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
  • UniProt number
    Q9R278&Q9R103
  • About
    Rats are used to make rat monoclonal anti mouse antibodies. There are less rat- than mouse clones however. Rats genes from rodents of the genus Rattus norvegicus are often studied in vivo as a model of human genes in Sprague-Dawley or Wistar rats.
  • Latin name
    Rattus norvegicus
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Gene symbol
    IFNLR1, PIRC55, PIRC57, PIRC53, PIRC54, PIRC56, SNORD115-12, SNORD114-12, IGHV3OR16-12
  • Short name
    Recombinant Interleukin-12/IL-12 (C-6His)
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Host
    Rat
  • Species
    Rat, Rats
  • Alternative name
    Recombinant Rat IL-12 (C-6His)
  • Alternative technique
    rec
Gene info
  • Identity
  • Gene
  • Long gene name
    interferon lambda receptor 1
  • Synonyms gene
  • Synonyms gene name
    • interleukin 28 receptor, alpha
    • interleukin 28 receptor, alpha (interferon, lambda receptor)
    • interferon, lambda receptor 1
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    2002-12-02
  • Entrez gene record
  • RefSeq identity
  • Classification
    • Interferon receptors
  • VEGA ID
Gene info
  • Identity
  • Gene
  • Long gene name
    piwi-interacting RNA cluster 55
  • Locus
    12
  • Discovery year
    2009-11-05
  • Entrez gene record
  • Pubmed identfication
  • Classification
    • Piwi-interacting RNA clusters
Gene info
  • Identity
  • Gene
  • Long gene name
    piwi-interacting RNA cluster 57
  • Locus
    12
  • Discovery year
    2009-11-05
  • Entrez gene record
  • Pubmed identfication
  • Classification
    • Piwi-interacting RNA clusters
Gene info
  • Identity
  • Gene
  • Long gene name
    piwi-interacting RNA cluster 53
  • Locus
    12
  • Discovery year
    2009-11-05
  • Entrez gene record
  • Pubmed identfication
  • Classification
    • Piwi-interacting RNA clusters
Gene info
  • Identity
  • Gene
  • Long gene name
    piwi-interacting RNA cluster 54
  • Locus
    12
  • Discovery year
    2009-11-05
  • Entrez gene record
  • Pubmed identfication
  • Classification
    • Piwi-interacting RNA clusters
Gene info
  • Identity
  • Gene
  • Long gene name
    piwi-interacting RNA cluster 56
  • Locus
    12
  • Discovery year
    2009-11-05
  • Entrez gene record
  • Pubmed identfication
  • Classification
    • Piwi-interacting RNA clusters
Gene info
Gene info
Gene info
  • Identity
  • Gene
  • Long gene name
    immunoglobulin heavy variable 3/OR16-12 (non-functional)
  • Synonyms gene name
    • immunoglobulin heavy variable 3/OR16-12
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    2000-04-17
  • Entrez gene record
  • Classification
    • Immunoglobulin heavy (IGH) orphons
  • VEGA ID
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee