Recombinant Rabbit B7-1/CD80 (C-6His)

  • Catalog number
    CP57-500
  • Price
    Please ask
  • Size
    500 ug
  • Description
    Recombinant Rabbit T-lymphocyte Activation Antigen CD82 is produced by our Mammalian expression system and the target gene encoding Gly33-Gln241 is expressed with a 6His tag at the C-terminus.
  • Species reactivity
    Rabbit
  • Origin
    Human cells
  • Peptide sequence
    GISQVTKSVKEMAALSCDYNISIDELARMRIYWQKDQQMVLSIISGQVEVWPEYKNRTFPDIINNLSLMILALRLSDKGTYTCVVQKNENGSFRREHLTSVTLSIRADFPVPSITDIGHPDPNVKRIRCSASGGFPEPRLAWMEDGEELNAVNTTVDQDLDTELYSVSSELDFNVTNNHSIVCLIKYGELSVSQIFPWSKPKQEPPIDQHHHHHH
  • Estimated molecular weight
    24,5 kDa
  • Protein purity
    Greater than 95% as determined by reducing SDS-PAGE.
  • Endotoxin level
    Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
  • Shipping condition
    Ambient/Room Temperature
  • Package form
    Lyophilized from a 0.2 µm filtered solution of PBS, pH7.4.
  • Storage conditions
    Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
  • Reconstitution conditions
    See included datasheet or contact us for more information.
  • UniProt number
    P42070
  • About
    Rabbits are used for polyclonal antibody production by novo. Rabbit antibodies are very stable and can be stored for several days at room temperature. novo adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
  • Latin name
    Oryctolagus cuniculus
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Gene symbol
    CD80, HHLA2, RNY4P2, LRRC23, PCDHGB7, NCR3LG1, CD274, CD86, TLX1NB, CD276
  • Short name
    Recombinant Rabbit B7-1/CD80 (C-6His)
  • Technique
    Recombinant, Rabbit, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Host
    Rabbit, Rabbits
  • Alternative name
    Recombinant Rabbit CD80 (C-6His)
  • Alternative technique
    rec, rabbit-anti
  • Alternative to gene target
    CD80 molecule, B7 and B7-1 and B7.1 and BB1 and CD28LG and CD28LG1 and LAB7, CD80 and IDBG-51287 and ENSG00000121594 and 941, coreceptor activity, Cell surfaces, Cd80 and IDBG-160288 and ENSMUSG00000075122 and 12519, BT.27986 and IDBG-632750 and ENSBTAG00000018059 and 407131
Gene info
Gene info
Gene info
  • Identity
  • Gene
  • Long gene name
    RNY4 pseudogene 2
  • Synonyms gene name
    • RNA, Y4 small cytoplasmic (associated with Ro protein) pseudogene 2
    • RNA, Ro-associated Y4 pseudogene 2
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    1993-08-25
  • Entrez gene record
  • RefSeq identity
Gene info
Gene info
Gene info
Gene info
Gene info
Gene info
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee