Recombinant Mouse Nephroblastoma Overexpressed Gene /NOV/CCN3/IGFBP-9 (C-6His)

  • Catalog number
    CM47-1000
  • Price
    Please ask
  • Size
    1 mg
  • Description
    Recombinant Mouse CCN3 is produced by our Mammalian expression system and the target gene encoding Ser26-Ile354 is expressed with a 6His tag at the C-terminus.
  • Species reactivity
    Mouse
  • Origin
    Human Cells
  • Peptide sequence
    SLRCPSRCPPKCPSISPTCAPGVRSVLDGCSCCPVCARQRGESCSEMRPCDQSSGLYCDRSADPNNQTGICMVPEGDNCVFDGVIYRNGEKFEPNCQYFCTCRDGQIGCLPRCQLDVLLPGPDCPAPRKVAVPGECCEKWTCGSDEQGTQGTLGGLALPAYRPEATVGVEVSDSSINCIEQTTEWSACSKSCGMGVSTRVTNRNRQCEMVKQTRLCIVRPCEQEPEEVTDKKGKKCLRTKKSLKAIHLQFENCTSLYTYKPRFCGVCSDGRCCTPHNTKTIQVEFQCLPGEIIKKPVMVIGTCTCYSNCPQNNEAFLQDLELKTSRGEIVDHHHHHH
  • Estimated molecular weight
    39,1 kDa
  • Protein purity
    Greater than 95% as determined by reducing SDS-PAGE.
  • Endotoxin level
    Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
  • Shipping condition
    Ambient/Room Temperature
  • Package form
    Lyophilized from a 0.2 µm filtered solution of PBS, pH7.4.
  • Storage conditions
    Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at below -20°C for 3 months.
  • Reconstitution conditions
    See included datasheet or contact us for more information.
  • UniProt number
    Q64299
  • Additional description
    cDNA genes are a locus (or region) of DNA for functional transcript RNA or protein. An ELISA is used to detect the expressed protein in biological fluids, serum, saliva.
  • Test
    Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain.
  • Latin name
    Mus musculus
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Gene symbol
    CCN3, IGFBP-AS1, PLXNA1, IGFBP4, RNU6-9, TMEM219, PIRC45
  • Short name
    Recombinant Mouse Nephroblastoma Overexpressed /NOV/CCN3/IGFBP-9 (C-6His)
  • Technique
    Recombinant, Mouse, mouses, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Host
    mouse
  • Species
    Mouse, Mouses
  • Alternative name
    Mouse NOV/CCN3/IGFBP-9(C-6His)
  • Alternative technique
    rec, murine
Gene info
  • Identity
  • Gene
  • Long gene name
    cellular communication network factor 3
  • Synonyms gene
  • Synonyms gene name
    • nephroblastoma overexpressed gene
    • nephroblastoma overexpressed
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    1993-11-05
  • Entrez gene record
  • Pubmed identfication
  • RefSeq identity
  • Classification
    • Cellular communication network factors
  • VEGA ID
Gene info
  • Identity
  • Gene
  • Long gene name
    IGFBP5 antisense RNA 1
  • Locus
  • Discovery year
    2021-06-30
  • Entrez gene record
  • Classification
    • Antisense RNAs
Gene info
Gene info
Gene info
Gene info
Gene info
  • Identity
  • Gene
  • Long gene name
    piwi-interacting RNA cluster 45
  • Locus
    9
  • Discovery year
    2009-11-05
  • Entrez gene record
  • Pubmed identfication
  • Classification
    • Piwi-interacting RNA clusters
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee