Recombinant Mouse Granulocyte Colony-Stimulating Factor/G-CSF/CSF1

  • Catalog number
    CB75-1000
  • Price
    Please ask
  • Size
    1 mg
  • Description
    Recombinant Mouse Granulocyte Colony-Stimulating Factor is produced by our Mammalian expression system and the target gene encoding Val31-Ala208 is expressed.
  • Species reactivity
    Mouse
  • Origin
    Human Cells
  • Peptide sequence
    VPLVTVSALPPSLPLPRSFLLKSLEQVRKIQASGSVLLEQLCATYKLCHPEELVLLGHSLGIPKASLSGCSSQALQQTQCLSQLHSGLCLYQGLLQALSGISPALAPTLDLLQLDVANFATTIWQQMENLGVAPTVQPTQSAMPAFTSAFQRRAGGVLAISYLQGFLETARLALHHLA
  • Estimated molecular weight
    18,8 kDa
  • Protein purity
    Greater than 95% as determined by reducing SDS-PAGE.
  • Endotoxin level
    Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
  • Shipping condition
    Ambient/Room Temperature
  • Package form
    Lyophilized from a 0.2 µm filtered solution of PBS, pH7.4.
  • Storage conditions
    Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at below -20°C for 3 months.
  • Reconstitution conditions
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
  • UniProt number
    P09920
  • Additional description
    Colonies can be formed by stimulating factors or recombinant GM-CSF and CSFs activity expressed in Units compared to a standard. Aplha, transcription related growth factors and stimulating factors or repressing nuclear factors are complex subunits of proteins involved in cell differentiation. Complex subunit associated factors are involved in hybridoma growth, Eosinohils, eritroid proliferation and derived from promotor binding stimulating subunits on the DNA binding complex. NFKB 105 subunit for example is a polypetide gene enhancer of genes in B cells.
  • Gene
    Granulocyte-colony stimulating factor (G-CSF or GCSF), also known as colony-stimulating factor 3 (CSF 3), is a glycoprotein that stimulates the bone marrow to produce granulocytes and stem cells and release them into the bloodstream. Functionally, it is a cytokine and hormone, a type of colony-stimulating factor, and is produced by a number of different tissues. The pharmaceutical analogs of naturally occurring G-CSF are called filgrastim and lenograstim.
  • Test
    Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain.
  • Latin name
    Mus musculus
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Gene symbol
    CSF3, CSF1, IGHV3-71, HLA-G, NCAPG, FOLR3, CSF2, SNRPG, GNAO1, SFTA2
  • Short name
    Recombinant Mouse Granulocyte Colony-Stimulating Factor/G-CSF/CSF1
  • Technique
    Recombinant, Mouse, mouses, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Host
    mouse
  • Species
    Mouse, Mouses
  • Alternative name
    Recombinant Mouse G-CSF
  • Alternative technique
    rec, murine
  • Alternative to gene target
    colony stimulating factor 1 (macrophage), CSF-1 and MCSF, CSF1 and IDBG-100920 and ENSG00000184371 and 1435, protein homodimerization activity, Extracellular, Csf1 and IDBG-185535 and ENSMUSG00000014599 and 12977, CSF1 and IDBG-635251 and ENSBTAG00000000283 and 281094
  • Tissue
    granulocyte
Gene info
Gene info
Gene info
  • Identity
  • Gene
  • Long gene name
    immunoglobulin heavy variable 3-71 (pseudogene)
  • Synonyms gene
  • Synonyms gene name
    • immunoglobulin heavy variable 3-71
    • immunoglobulin heavy variable 3-G pseudogene (provisional)
    • immunoglobulin heavy variable 3-G (provisional)
    • immunoglobulin heavy variable 3-71 pseudogene
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    2000-04-04
  • Entrez gene record
  • RefSeq identity
  • Classification
    • Immunoglobulin heavy locus at 14q32.33
  • VEGA ID
Gene info
Gene info
Gene info
Gene info
Gene info
Gene info
  • Identity
  • Gene
  • Long gene name
    G protein subunit alpha o1
  • Synonyms gene name
    • guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O
  • Synonyms
  • Locus
  • Discovery year
    1988-04-24
  • Entrez gene record
  • Pubmed identfication
  • RefSeq identity
  • Classification
    • G protein subunits alpha, group i
    • MicroRNA protein coding host genes
  • VEGA ID
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee