Recombinant Mouse Complement Component C5

#
  • Catalog number
    C075-50
  • Price:

    Please ask

    Ask for price
  • Size
    50 ug
# #
  • Description
    Recombinant Mouse Complement Component C5 is produced by our E.coli expression system and the target gene encoding Asn679-Arg755 is expressed.
  • Species reactivity
    Mouse
  • Origin
    Escherichia coli
  • Peptide sequence
    MNLHLLRQKIEEQAAKYKHSVPKKCCYDGARVNFYETCEERVARVTIGPLCIRAFNECCTIANKIRKESPHKPVQLGR
  • Estimated molecular weight
    9 kDa
  • Protein purity
    Greater than 95% as determined by reducing SDS-PAGE.
  • Endotoxin level
    Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
  • Shipping condition
    Ambient/Room Temperature
  • Package form
    Lyophilized from a 0.2 µm filtered solution of 20mM PB, 350mM NaCl, pH 7.5.
  • Storage conditions
    Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
  • Reconstitution conditions
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
  • UniProt number
    P06684
  • Test
    Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain.
  • Latin name
    Mus musculus
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
#
  • Gene target
  • Gene symbol
    C5
  • Short name
    Recombinant Mouse Complement Component C5
  • Technique
    Recombinant, Mouse, mouses, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Host
    mouse
  • Species
    Mouse, Mouses
  • Alternative name
    Mouse Complement Component C5/C5
  • Alternative technique
    rec, murine
  • Alternative to gene target
    complement component 5, C5a and C5b and C5D and CPAMD4 and ECLZB, C5 and IDBG-83167 and ENSG00000106804 and 727, C5a anaphylatoxin chemotactic receptor binding, Extracellular, Hc and IDBG-163835 and ENSMUSG00000026874 and 15139, BT.24055 and IDBG-638834 and ENSBTAG00000012210 and 512045
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee