Recombinant Mouse Adiponectin/Acrp30/AdipoQ ((N-6His, E. coli)

• Catalog number
  CH26-1000
• Price
  Please ask
• Size
  1 mg

• Description
  Recombinant Mouse Adiponectin is produced by our E.coli expression system and the target gene encoding Glu18-Asn247 is expressed with a 6His tag at the N-terminus.
• Species reactivity
  Mouse
• Origin
  Escherichia coli
• Peptide sequence
  MGSSHHHHHHSSGLVPRGSHMEDDVTTTEELAPALVPPPKGTCAGWMAGIPGHPGHNGTPGRDGRDGTPGEKGEKGDAGLLGPKGETGDVGMTGAEGPRGFPGTPGRKGEPGEAAYVYRSAFSVGLETRVTVPNVPIRFTKIFYNQQNHYDGSTGKFYCNIPGLYYFSYHITVYMKDVKVSLFKKDKAVLFTYDQYQEKNVDQASGSVLLHLEVGDQVWLQVYGDGDHNGLYADNVNDSTFTGFLLYHDTN
• Estimated molecular weight
  27,2 kDa
• Protein purity
  Greater than 95% as determined by reducing SDS-PAGE.
• Endotoxin level
  Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Shipping condition
  Ambient/Room Temperature
• Package form
  Lyophilized from a 0.2 µm filtered solution of PBS,pH7.4.
• Storage conditions
  Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at below -20°C for 3 months.
• Reconstitution conditions
  Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
• UniProt number
  Q60994
• Other related products
• Test
  Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain.
• Latin name
  Mus musculus
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  Adiponectin/Acrp30/AdipoQ   N-6His  
• Short name
  Recombinant Mouse Adiponectin/Acrp30/AdipoQ ((N-6His, )
• Technique
  Recombinant, Mouse, mouses, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Host
  mouse, Escherichia coli, Recombination of bioactive proteins and longer peptides in Escherichia Coli is done often with His tagging. novo supplies Rec. E. Coli affinity purified or tag purified antigens in 1 quantities or bulk volumes on request.
• Species
  E. coli, E. coli, Mouses
• Alternative name
  Mouse Adiponectin/Acrp30(N-6His)
• Alternative technique
  rec, murine, escherichia
• Alternative to gene target
  adiponectin, C1Q and collagen domain containing, ACDC and ACRP30 and ADIPQTL1 and ADPN and APM-1 and APM1 and GBP28, ADIPOQ and IDBG-69167 and ENSG00000181092 and 9370, protein homodimerization activity, Extracellular, Adipoq and IDBG-149533 and ENSMUSG00000022878 and 11450, ADIPOQ and IDBG-634641 and ENSBTAG00000019813 and 282865

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Product images

Similar products