Recombinant Mouse 4-1BB/TNFRSF9/CD137 (C-Fc)

  • Catalog number
    CI69-1000
  • Price
    Please ask
  • Size
    1 mg
  • Description
    Recombinant Mouse 4-1BB ligand receptor is produced by our Mammalian expression system and the target gene encoding Val24-Leu187 is expressed with a Fc tag at the C-terminus.
  • Species reactivity
    Mouse
  • Origin
    Human Cells
  • Peptide sequence
    VQNSCDNCQPGTFCRKYNPVCKSCPPSTFSSIGGQPNCNICRVCAGYFRFKKFCSSTHNAECECIEGFHCLGPQCTRCEKDCRPGQELTKQGCKTCSLGTFNDQNGTGVCRPWTNCSLDGRSVLKTGTTEKDVVCGPPVVSFSPSTTISVTPEGGPGGHSLQVLVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
  • Estimated molecular weight
    44,7 kDa
  • Protein purity
    Greater than 95% as determined by reducing SDS-PAGE.
  • Endotoxin level
    Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
  • Shipping condition
    Dry Ice/ice packs
  • Package form
    Supplied as a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4.
  • Storage conditions
    Store at below -20°C, stable for 6 months after receipt.Please minimize freeze-thaw cycles.
  • Reconstitution conditions
    See included datasheet or contact us for more information.
  • UniProt number
    P20334
  • Test
    Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain.
  • Latin name
    Mus musculus
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Gene symbol
    TNFRSF9, TNFSF9, MIR1302-4, PIRC18, PIRC16, SNORD114-4, IGKV2OR2-4, MIR941-4
  • Short name
    Recombinant Mouse 4-1BB/TNFRSF9/CD137 (C-Fc)
  • Technique
    Recombinant, Mouse, FC, mouses, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Host
    mouse
  • Species
    Mouse, Mouses
  • Alternative name
    Mouse 4-1BB/TNFRSF9/CD137(C-Fc)
  • Alternative technique
    rec, murine
  • Alternative to gene target
    tumor necrosis factor receptor superfamily, member 9, 4-1BB and CD137 and CDw137 and ILA, TNFRSF9 and IDBG-88268 and ENSG00000049249 and 3604, cytokine binding, Extracellular, Tnfrsf9 and IDBG-205902 and ENSMUSG00000028965 and 21942, BT.49346 and IDBG-633668 and ENSBTAG00000003313 and 520341
Gene info
  • Identity
  • Gene
  • Long gene name
    TNF receptor superfamily member 9
  • Synonyms gene
  • Synonyms gene name
    • tumor necrosis factor receptor superfamily, member 9
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    1996-06-12
  • Entrez gene record
  • Pubmed identfication
  • Classification
    • Tumor necrosis factor receptor superfamily
    • CD molecules
  • VEGA ID
Gene info
Gene info
Gene info
  • Identity
  • Gene
  • Long gene name
    piwi-interacting RNA cluster 18
  • Locus
    4
  • Discovery year
    2009-11-05
  • Entrez gene record
  • Pubmed identfication
  • Classification
    • Piwi-interacting RNA clusters
Gene info
  • Identity
  • Gene
  • Long gene name
    piwi-interacting RNA cluster 16
  • Locus
    4
  • Discovery year
    2009-11-05
  • Entrez gene record
  • Pubmed identfication
  • Classification
    • Piwi-interacting RNA clusters
Gene info
Gene info
  • Identity
  • Gene
  • Long gene name
    immunoglobulin kappa variable 2/OR2-4 (pseudogene)
  • Synonyms gene name
    • immunoglobulin kappa variable 2/OR2-4
    • immunoglobulin kappa variable 2/OR2-4 pseudogene
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    2000-04-18
  • Entrez gene record
  • Pubmed identfication
  • Classification
    • Immunoglobulin kappa (IGK) orphons
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee