Recombinant Human V-Set and Ig Domain-Containing Protein 2/VSIG2 (C-6His)

• Catalog number
  C548-10
• Price
  Please ask
• Size
  10 ug

• Description
  Recombinant Human VSIG2 is produced by our Mammalian expression system and the target gene encoding Val24-Ala243 is expressed with a 6His tag at the C-terminus.
• Species reactivity
  Human
• Origin
  Human cells
• Peptide sequence
  VEVKVPTEPLSTPLGKTAELTCTYSTSVGDSFALEWSFVQPGKPISESHPILYFTNGHLYPTGSKSKRVSLLQNPPTVGVATLKLTDVHPSDTGTYLCQVNNPPDFYTNGLGLINLTVLVPPSNPLCSQSGQTSVGGSTALRCSSSEGAPKPVYNWVRLGTFPTPSPGSMVQDEVSGQLILTNLSLTSSGTYRCVATNQMGSASCELTLSVTEPSQGRVAVDHHHHHH
• Estimated molecular weight
  24,2 kDa
• Protein purity
  Greater than 95% as determined by reducing SDS-PAGE.
• Endotoxin level
  Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Shipping condition
  Ambient/Room Temperature
• Package form
  Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
• Storage conditions
  Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
• Reconstitution conditions
  Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
• UniProt number
  Q96IQ7
• Other related products
• Properties
  Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  V-Set   Domain   Protein   2/VSIG2   C-6His  
• Gene symbol
  VSIG2
• Short name
  Recombinant V-Set Ig Domain- Protein 2/VSIG2 (C-6His)
• Technique
  Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Species
  Human, Humans
• Alternative name
  Human VSIG2(C-6His)
• Alternative technique
  rec
• Alternative to gene target
  V-set and immunoglobulin domain containing 2, 2210413P10Rik and CTH and CTXL, VSIG2 and IDBG-75251 and ENSG00000019102 and 23584, protein binding, Plasma membranes, Vsig2 and IDBG-150444 and ENSMUSG00000001943 and 57276, VSIG2 and IDBG-642611 and ENSBTAG00000022379 and 616943
• Tissue
  set

Gene info

• Identity
  HGNC:17149
• Gene
  VSIG2
• Long gene name
  V-set and immunoglobulin domain containing 2
• Synonyms
  • CTXL
  • CTH
• GenBank acession
  • AF061022
• Locus
  11q24.2
• Discovery year
  2004-09-02
• Entrez gene record
  23584
• Pubmed identfication
  • 9862345
• RefSeq identity
  • NM_014312
• Classification
  • IgCAM CXADR-related subfamily
  • I-set domain containing
  • V-set domain containing
• VEGA ID
  OTTHUMG00000150357

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Product images

Similar products