Recombinant Human TREML1/TLT-1 (C-Fc)

  • Catalog number
    CD07-10
  • Price
    Please ask
  • Size
    10 ug
  • Description
    Recombinant Human TREML1 is produced by our Mammalian expression system and the target gene encoding Gln16-Pro162 is expressed with a Fc tag at the C-terminus.
  • Species reactivity
    Human
  • Origin
    Human cells
  • Peptide sequence
    QGIVGSLPEVLQAPVGSSILVQCHYRLQDVKAQKVWCRFLPEGCQPLVSSAVDRRAPAGRRTFLTDLGGGLLQVEMVTLQEEDAGEYGCMVDGARGPQILHRVSLNILPPEEEEETHKIGSLAENAFSDPAGSANPLEPSQDEKSIPVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
  • Estimated molecular weight
    42,9 kDa
  • Protein purity
    Greater than 95% as determined by reducing SDS-PAGE.
  • Endotoxin level
    Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
  • Shipping condition
    Ambient/Room Temperature
  • Package form
    Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4.
  • Storage conditions
    Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
  • Reconstitution conditions
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
  • UniProt number
    Q86YW5
  • Properties
    Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Gene symbol
    TREML1, IGHVII-1-1, MIR1-1, TRUND-NNN8-1, TRUND-NNN7-1, IGKV1OR2-1, MIR101-1, MIR1289-1, MIR16-1
  • Short name
    Recombinant TREML1/TLT-1 (C-Fc)
  • Technique
    Recombinant, FC, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Species
    Human, Humans
  • Alternative name
    Human TREML1/TLT-1(C-Fc)
  • Alternative technique
    rec
  • Alternative to gene target
    triggering receptor expressed on myeloid cells-like 1, TREML1 and IDBG-86561 and ENSG00000161911 and 340205, protein binding, Cell surfaces, Treml1 and IDBG-189902 and ENSMUSG00000023993 and 71326, TREML1 and IDBG-630847 and ENSBTAG00000006485 and 784711
Gene info
Gene info
  • Identity
  • Gene
  • Long gene name
    immunoglobulin heavy variable (II)-1-1 (pseudogene)
  • Synonyms gene name
    • immunoglobulin heavy variable (II)-1-1
    • immunoglobulin heavy variable (II)-1-1 pseudogene
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    2000-04-17
  • Entrez gene record
  • RefSeq identity
  • Classification
    • Immunoglobulin heavy locus at 14q32.33
  • VEGA ID
Gene info
Gene info
  • Identity
  • Gene
  • Long gene name
    tRNA-undetermined (NNN) 8-1
  • Synonyms gene name
    • transfer RNA-undetermined (NNN) 8-1
  • GenBank acession
  • Locus
    1
  • Discovery year
    2014-06-20
  • Entrez gene record
  • Pubmed identfication
Gene info
  • Identity
  • Gene
  • Long gene name
    tRNA-undetermined (NNN) 7-1
  • Synonyms gene name
    • transfer RNA-undetermined (NNN) 7-1
  • GenBank acession
  • Locus
    1
  • Discovery year
    2014-06-20
  • Entrez gene record
  • Pubmed identfication
Gene info
  • Identity
  • Gene
  • Long gene name
    immunoglobulin kappa variable 1/OR2-1 (pseudogene)
  • Synonyms gene
  • Synonyms gene name
    • immunoglobulin kappa variable 1/OR-1
    • immunoglobulin kappa variable 1/OR-1 pseudogene
    • immunoglobulin kappa variable 1/OR-1 (pseudogene)
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    2000-04-18
  • Entrez gene record
  • Pubmed identfication
  • Classification
    • Immunoglobulin kappa (IGK) orphons
  • VEGA ID
Gene info
Gene info
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee