Recombinant Human Trefoil Factor 1/TFF1 (C-6His)

• Catalog number
  C659-50
• Price
  Please ask
• Size
  50 ug

• Description
  Recombinant Human Trefoil Factor 1 is produced by our Mammalian expression system and the target gene encoding Glu25-Phe84 is expressed with a 6His at the C-terminus.
• Species reactivity
  Human
• Origin
  Human cells
• Peptide sequence
  EAQTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPEEECEFHHHHHH
• Estimated molecular weight
  7,5 kDa
• Protein purity
  Greater than 95% as determined by reducing SDS-PAGE.
• Endotoxin level
  Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Shipping condition
  Ambient/Room Temperature
• Package form
  Lyophilized from a 0.2 µm filtered solution of PBS, pH7.4.
• Storage conditions
  Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
• Reconstitution conditions
  See included datasheet or contact us for more information.
• UniProt number
  P04155
• Other related products
• Additional description
  Aplha, transcription related growth factors and stimulating factors or repressing nuclear factors are complex subunits of proteins involved in cell differentiation. Complex subunit associated factors are involved in hybridoma growth, Eosinohils, eritroid proliferation and derived from promotor binding stimulating subunits on the DNA binding complex. NFKB 105 subunit for example is a polypetide gene enhancer of genes in B cells.
• Properties
  Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  Trefoil   Factor   1/TFF1   C-6His  
• Gene symbol
  TFF1
• Short name
  Recombinant Trefoil Factor 1/TFF1 (C-6His)
• Technique
  Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Species
  Human, Humans
• Alternative name
  Recombinant Human TFF1 (C-6His)
• Alternative technique
  rec

Gene info

• Identity
  HGNC:11755
• Gene
  TFF1
• Long gene name
  trefoil factor 1
• Synonyms gene
  • BCEI
• Synonyms gene name
  • breast cancer, estrogen-inducible sequence expressed in
• Synonyms
  • D21S21
  • HPS2
  • pS2
  • pNR-2
  • HP1.A
• GenBank acession
  • BC032811
• Locus
  21q22.3
• Discovery year
  2001-06-22
• Entrez gene record
  7031
• Pubmed identfication
  • 9043862
• RefSeq identity
  • NM_003225
• VEGA ID
  OTTHUMG00000086799

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Product images

Similar products