Recombinant Human SMAD Family Member 1/SMAD1 (N-GST)

  • Catalog number
    CE81-10
  • Price
    Please ask
  • Size
    10 ug
  • Description
    Recombinant Human SMAD1 is produced by our E.coli expression system and the target gene encoding Met1-Ser465 is expressed with a GST tag at the N-terminus.
  • Species reactivity
    Human
  • Origin
    Escherichia coli
  • Peptide sequence
    MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSHMNVTSLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSCPGQPSNCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLECCEFPFGSKQKEVCINPYHYKRVESPVLPPVLVPRHSEYNPQHSLLAQFRNLGQNEPHMPLNATFPDSFQQPNSHPFPHSPNSSYPNSPGSSSSTYPHSPTSSDPGSPFQMPADTPPPAYLPPEDPMTQDGSQPMDTNMMAPPLPSEINRGDVQAVAYEEPKHWCSIVYYELNNRVGEAFHASSTSVLVDGFTDPSNNKNRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVYAECLSDSSIFVQSRNCNYHHGFHPTTVCKIPSGCSLKIFNNQEFAQLLAQSVNHGFETVYELTKMCTIRMSFVKGWGAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSPHNPISSVS
  • Estimated molecular weight
    78,69 kDa
  • Protein purity
    Greater than 95% as determined by reducing SDS-PAGE.
  • Endotoxin level
    Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
  • Shipping condition
    Ambient/Room Temperature
  • Package form
    Lyophilized from a 0.2 µm filtered solution of 20mM TrisHCl, 150mM NaCl, pH 8.0 .
  • Storage conditions
    Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
  • Reconstitution conditions
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
  • UniProt number
    Q15797
  • Properties
    Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
    SMAD   Family   Member   1/SMAD1   N-GST  
  • Gene symbol
    SMAD1-AS2, MGST3, SMAD1-AS1, GH1, POLM, SMAD1, NRAS, GARS1, SDC3, PIGN
  • Short name
    Recombinant SMAD Family Member 1/SMAD1 (N-GST)
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Species
    Human, Humans
  • Alternative name
    Human SMAD1/BSP1(N-GST)
  • Alternative technique
    rec
  • Alternative to gene target
    SMAD family member 1, BSP-1 and BSP1 and JV4-1 and JV41 and MADH1 and MADR1, SMAD1 and IDBG-39936 and ENSG00000170365 and 4086, transforming growth factor beta receptor, nuclei, Smad1 and IDBG-170516 and ENSMUSG00000031681 and 17125, SMAD1 and IDBG-629431 and ENSBTAG00000002835 and 540488
Gene info
Gene info
Gene info
Gene info
Gene info
  • Identity
  • Gene
  • Long gene name
    DNA polymerase mu
  • Synonyms gene name
    • polymerase (DNA directed), mu
    • polymerase (DNA) mu
  • Synonyms
  • Synonyms name
  • GenBank acession
  • Locus
  • Discovery year
    2000-02-16
  • Entrez gene record
  • Pubmed identfication
  • RefSeq identity
  • Classification
    • DNA polymerases
    • MicroRNA protein coding host genes
  • VEGA ID
Gene info
  • Identity
  • Gene
  • Long gene name
    SMAD family member 1
  • Synonyms gene
  • Synonyms gene name
    • MAD, mothers against decapentaplegic homolog 1 (Drosophila)
    • SMAD, mothers against DPP homolog 1 (Drosophila)
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    1996-11-15
  • Entrez gene record
  • Pubmed identfication
  • RefSeq identity
  • Classification
    • SMAD family
  • VEGA ID
Gene info
Gene info
Gene info
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee