Recombinant Human Serine Protease HTRA2/HTRA2/Omi (C-6His)

• Catalog number
  C760-10
• Price
  Please ask
• Size
  10 ug

• Description
  Recombinant Human HTRA2 is produced by our Mammalian expression system and the target gene encoding Ala134-Glu458 is expressed with a 6His tag at the C-terminus.
• Species reactivity
  Human
• Origin
  Human cells
• Peptide sequence
  AVPSPPPASPRSQYNFIADVVEKTAPAVVYIEILDRHPFLGREVPISNGSGFVVAADGLIVTNAHVVADRRRVRVRLLSGDTYEAVVTAVDPVADIATLRIQTKEPLPTLPLGRSADVRQGEFVVAMGSPFALQNTITSGIVSSAQRPARDLGLPQTNVEYIQTDAAIDFGNSGGPLVNLDGEVIGVNTMKVTAGISFAIPSDRLREFLHRGEKKNSSSGISGSQRRYIGVMMLTLSPSILAELQLREPSFPDVQHGVLIHKVILGSPAHRAGLRPGDVILAIGEQMVQNAEDVYEAVRTQSQLAVQIRRGRETLTLYVTPEVTEVDHHHHHH
• Estimated molecular weight
  36 kDa
• Protein purity
  Greater than 95% as determined by reducing SDS-PAGE.
• Endotoxin level
  Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Shipping condition
  Dry Ice/ice packs
• Package form
  Supplied as a 0.2 µm filtered solution of 20mM Tris,150mM NaCl,pH7.5.
• Storage conditions
  Store at below -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
• Reconstitution conditions
  See included datasheet or contact us for more information.
• UniProt number
  O43464
• Other related products
• Properties
  Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
• Source
  Recombinants or rec. proteins
• Group
  recombinants
• Additional description
  Serine protease, D- or L-serine arginine rich enzyme of serine threonine kinase with serine that is encoded by the codons UCU, UCC, UCA, UCG, AGU and AGC is an ɑ-amino acid that is used in the biosynthesis of proteins. It contains an α-amino group (which is in the protonated −NH+ 3 form under biological conditions), a carboxyl group. It is non-essential in humans, meaning the body can synthesize it.

• Gene target
  Serine   Protease   HTRA2/HTRA2/Omi   C-6His  
• Gene symbol
  HTRA2, TRA2B
• Short name
  Recombinant Serine Protease HTRA2/HTRA2/Omi (C-6His)
• Technique
  Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Species
  Human, Humans
• Alternative name
  Human HTRA2/Omi (C-6His)
• Alternative technique
  rec
• Alternative to gene target
  HtrA serine peptidase 2, HTRA2 and IDBG-57753 and ENSG00000115317 and 27429, unfolded protein binding, nuclei, Htra2 and IDBG-159586 and ENSMUSG00000068329 and 64704, HTRA2 and IDBG-631258 and ENSBTAG00000020124 and 523039

Gene info

• Identity
  HGNC:14348
• Gene
  HTRA2
• Long gene name
  HtrA serine peptidase 2
• Synonyms gene
  • PRSS25
• Synonyms gene name
  • protease, serine, 25
• Synonyms
  • OMI
  • PARK13
• Locus
  2p13.1
• Discovery year
  2001-09-26
• Entrez gene record
  27429
• Pubmed identfication
  • 10644717
  • 10971580
• RefSeq identity
  • NM_013247
• Classification
  • PDZ domain containing
  • Serine proteases
• VEGA ID
  OTTHUMG00000129957

Gene info

• Identity
  HGNC:10781
• Gene
  TRA2B
• Long gene name
  transformer 2 beta homolog
• Synonyms gene
  • SFRS10
• Synonyms gene name
  • splicing factor, arginine/serine-rich 10 (transformer 2 homolog, Drosophila)
  • transformer 2 beta homolog (Drosophila)
• Synonyms
  • Htra2-beta
  • PPP1R156
• Synonyms name
  • protein phosphatase 1, regulatory subunit 156
• GenBank acession
  • AF057159
• Locus
  3q27.2
• Discovery year
  1998-04-27
• Entrez gene record
  6434
• Pubmed identfication
  • 9790768
• RefSeq identity
  • NM_004593
• Classification
  • Protein phosphatase 1 regulatory subunits
  • RNA binding motif containing
• VEGA ID
  OTTHUMG00000156641

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Product images

Similar products