Recombinant Human Receptor Tyrosine Kinase MerTK/MERTK/MER (C-6His)

• Catalog number
  CI94-50
• Price
  Please ask
• Size
  50 ug

• Description
  Recombinant Human Tyrosine-protein kinase Mer is produced by our Mammalian expression system and the target gene encoding Met177-Ala499 is expressed with a 6His tag at the C-terminus.
• Species reactivity
  Human
• Origin
  Human cells
• Peptide sequence
  MKINNEEIVSDPIYIEVQGLPHFTKQPESMNVTRNTAFNLTCQAVGPPEPVNIFWVQNSSRVNEQPEKSPSVLTVPGLTEMAVFSCEAHNDKGLTVSKGVQINIKAIPSPPTEVSIRNSTAHSILISWVPGFDGYSPFRNCSIQVKEADPLSNGSVMIFNTSALPHLYQIKQLQALANYSIGVSCMNEIGWSAVSPWILASTTEGAPSVAPLNVTVFLNESSDNVDIRWMKPPTKQQDGELVGYRISHVWQSAGISKELLEEVGQNGSRARISVQVHNATCTVRIAAVTKGGVGPFSDPVKIFIPAHGWVDYAPSSTPAPGNAVDHHHHHH
• Estimated molecular weight
  36 kDa
• Protein purity
  Greater than 95% as determined by reducing SDS-PAGE.
• Endotoxin level
  Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Shipping condition
  Ambient/Room Temperature
• Package form
  Lyophilized from a 0.2 µm filtered solution of 20mM Tris,150mM NaCl,pH8.0.
• Storage conditions
  Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
• Reconstitution conditions
  Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
• UniProt number
  Q12866
• Other related products
• Properties
  Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
• Additional description
  The receptors are ligand binding factors of type 1, 2 or 3 and protein-molecules that receive chemical-signals from outside a cell. When such chemical-signals couple or bind to a receptor, they cause some form of cellular/tissue-response, e.g. a change in the electrical-activity of a cell. In this sense, am olfactory receptor is a protein-molecule that recognizes and responds to endogenous-chemical signals, chemokinesor cytokines e.g. an acetylcholine-receptor recognizes and responds to its endogenous-ligand, acetylcholine. However, sometimes in pharmacology, the term is also used to include other proteins that are drug-targets, such as enzymes, transporters and ion-channels.
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  Receptor   Tyrosine   Kinase   MerTK/MERTK/MER   C-6His  
• Gene symbol
  MERTK
• Short name
  Recombinant Receptor Tyrosine Kinase MerTK/MERTK/MER (C-6His)
• Technique
  Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Species
  Human, Humans
• Alternative name
  Human Mer/MerTK(C-6His)
• Alternative technique
  rec
• Alternative to gene target
  c-mer proto-oncogene tyrosine kinase, c-mer and MER and RP38, MERTK and IDBG-66030 and ENSG00000153208 and 10461, transferase activity, Extracellular, Mertk and IDBG-205458 and ENSMUSG00000014361 and 17289, MERTK and IDBG-628865 and ENSBTAG00000005828 and 504429

Gene info

• Identity
  HGNC:7027
• Gene
  MERTK
• Long gene name
  MER proto-oncogene, tyrosine kinase
• Synonyms gene name
  • c-mer proto-oncogene tyrosine kinase
• Synonyms
  • mer
  • RP38
  • c-Eyk
  • Tyro12
• GenBank acession
  • U08023
• Locus
  2q13
• Discovery year
  1998-11-30
• Entrez gene record
  10461
• Pubmed identfication
  • 8086340
  • 10343112
• Classification
  • Receptor tyrosine kinases
  • Fibronectin type III domain containing
  • I-set domain containing
• VEGA ID
  OTTHUMG00000131278
• Locus Specific Databases
  • Mutations of the MER Receptor Tyrosine Kinase Gene

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Product images

Similar products