Recombinant Human Receptor Expressed in Lymphoid Tissues/RELT/TNFRSF19L (C-Fc)

• Catalog number
  CB80-10
• Price
  Please ask
• Size
  10 ug

• Description
  Recombinant Human Receptor Expressed in Lymphoid Tissues is produced by our Mammalian expression system and the target gene encoding Ser26-Ala160 is expressed with a Fc tag at the C-terminus.
• Species reactivity
  Human
• Origin
  Human cells
• Peptide sequence
  STTLWQCPPGEEPDLDPGQGTLCRPCPPGTFSAAWGSSPCQPHARCSLWRRLEAQVGMATRDTLCGDCWPGWFGPWGVPRVPCQPCSWAPLGTHGCDEWGRRARRGVEVAAGASSGGETRQPGNGTRAGGPEETAVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
• Estimated molecular weight
  41,4 kDa
• Protein purity
  Greater than 95% as determined by reducing SDS-PAGE.
• Endotoxin level
  Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Shipping condition
  Dry Ice/ice packs
• Package form
  Supplied as a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.2.
• Storage conditions
  Store at below -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
• Reconstitution conditions
  Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
• UniProt number
  Q969Z4
• Other related products
• Properties
  Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
• Additional description
  The receptors are ligand binding factors of type 1, 2 or 3 and protein-molecules that receive chemical-signals from outside a cell. When such chemical-signals couple or bind to a receptor, they cause some form of cellular/tissue-response, e.g. a change in the electrical-activity of a cell. In this sense, am olfactory receptor is a protein-molecule that recognizes and responds to endogenous-chemical signals, chemokinesor cytokines e.g. an acetylcholine-receptor recognizes and responds to its endogenous-ligand, acetylcholine. However, sometimes in pharmacology, the term is also used to include other proteins that are drug-targets, such as enzymes, transporters and ion-channels.
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  Receptor   Expressed   Lymphoid   Tissues/RELT/TNFRSF19L   C-Fc  
• Gene symbol
  RELT
• Short name
  Recombinant Receptor Expressed in Lymphoid Tissues/RELT/TNFRSF19L (C-Fc)
• Technique
  Recombinant, FC, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Species
  Human, Humans
• Alternative name
  Human RELT/TNFRSF19L(C-Fc)
• Alternative technique
  rec
• Alternative to gene target
  RELT tumor necrosis factor receptor, RELT and IDBG-63781 and ENSG00000054967 and 84957, Plasma membranes, Relt and IDBG-201680 and ENSMUSG00000008318 and 320100, RELT and IDBG-635302 and ENSBTAG00000016494 and 505716

Gene info

• Identity
  HGNC:13764
• Gene
  RELT
• Long gene name
  RELT TNF receptor
• Synonyms gene
  • TNFRSF19L
• Synonyms gene name
  • tumor necrosis factor receptor superfamily, member 19-like
  • RELT tumor necrosis factor receptor
• Synonyms
  • FLJ14993
• Synonyms name
  • receptor expressed in lymphoid tissues
• GenBank acession
  • AF319553
• Locus
  11q13.4
• Discovery year
  2002-02-08
• Entrez gene record
  84957
• Pubmed identfication
  • 11313261
  • 16547002
  • 16950202
  • 16389068
• RefSeq identity
  • NM_032871
• Classification
  • RELT family
  • Tumor necrosis factor receptor superfamily
• VEGA ID
  OTTHUMG00000167973

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Product images

Similar products