Recombinant Human Peptidyl-Prolyl Cis-Trans Isomerase H/PPIH (N-6His)

  • Catalog number
    C253-50
  • Price
    Please ask
  • Size
    50 ug
  • Description
    Recombinant Human PPIase H is produced by our E.coli expression system and the target gene encoding Met1-Met177 is expressed with a 6His tag at the N-terminus.
  • Species reactivity
    Human
  • Origin
    Escherichia coli
  • Peptide sequence
    MGSSHHHHHHSSGLVPRGSHMAVANSSPVNPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEFRKDGVPIGYKGSTFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTNGCQFFITCSKCDWLDGKHVVFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGEM
  • Estimated molecular weight
    21,4 kDa
  • Protein purity
    Greater than 95% as determined by reducing SDS-PAGE.
  • Endotoxin level
    Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
  • Shipping condition
    Dry ice/ice packs
  • Package form
    Supplied as a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
  • Storage conditions
    Store at below -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
  • Reconstitution conditions
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
  • UniProt number
    O43447
  • Properties
    Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Gene symbol
    PPIH
  • Short name
    Recombinant Peptidyl-Prolyl Cis-Trans Isomerase H/PPIH (N-6His)
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Species
    Human, Humans
  • Alternative name
    Human PPIase H/PPIH(N-6His)
  • Alternative technique
    rec
  • Alternative to gene target
    peptidylprolyl isomerase H (cyclophilin H), PPIH and IDBG-97224 and ENSG00000171960 and 10465, ribonucleoprotein complex binding, nuclei, Ppih and IDBG-182988 and ENSMUSG00000060288 and 433064,66101, PPIH and IDBG-640563 and ENSBTAG00000004590 and 513428
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee