Recombinant Human Parkinson Juvenile Disease Protein 2/PARK2 (C-6His)

• Catalog number
  CF59-500
• Price
  Please ask
• Size
  500 ug

• Description
  Recombinant Human Parkinson Juvenile Disease Protein 2 is produced by our E.coli expression system and the target gene encoding Met1-Lys387 is expressed with a 6His tag at the C-terminus.
• Species reactivity
  Human
• Origin
  Escherichia coli
• Peptide sequence
  MIVFVRFNSSHGFPVEVDSDTSIFQLKEVVAKRQGVPADQLRVIFAGKELRNDWTVQNCDLDQQSIVHIVQRPWRKGQEMNATGGDDPRNAAGGCEREPQSLTRVDLSSSVLPGDSVGLAVILHTDSRKDSPPAGSPAGRSIYNSFYVYCKGPCQRVQPGKLRVQCSTCRQATLTLTQGPSCWDDVLIPNRMSGECQSPHCPGTSAEFFFKCGAHPTSDKETSVALHLIATNSRNITCITCTDVRSPVLVFQCNSRHVICLDCFHLYCVTRLNDRQFVHDPQLGYSLPCVGTGDTVVLRGALGGFRRGVAGCPNSLIKELHHFRILGEEQYNRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEPDQRKVTCEGGNGLGCGYGQRRTKLEHHHHHH
• Estimated molecular weight
  43,4 kDa
• Protein purity
  Greater than 95% as determined by reducing SDS-PAGE.
• Endotoxin level
  Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Shipping condition
  Dry ice/ice packs
• Package form
  Supplied as a 0.2 µm filtered solution of 20mM PB,150mM NaCl,2mM DTT,20% Glycerol,pH7.4.
• Storage conditions
  Store at below -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
• Reconstitution conditions
  Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
• UniProt number
  O60260-5
• Other related products
• Properties
  Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  Parkinson   Juvenile   Disease   Protein   2/PARK2   C-6His  
• Gene symbol
  PRKN
• Short name
  Recombinant Parkinson Juvenile Disease Protein 2/PARK2 (C-6His)
• Technique
  Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Species
  Human, Humans
• Alternative name
  Human Parkinson Disease Protein 2/PARK2(C-6His)
• Alternative technique
  rec
• Disease
  parkinson

Gene info

• Identity
  HGNC:8607
• Gene
  PRKN
• Long gene name
  parkin RBR E3 ubiquitin protein ligase
• Synonyms gene
  • PARK2
• Synonyms gene name
  • Parkinson disease (autosomal recessive, juvenile) 2, parkin
  • parkinson protein 2, E3 ubiquitin protein ligase (parkin)
• Synonyms
  • PDJ
  • AR-JP
  • parkin
• Synonyms name
  • E3 ubiquitin ligase
• Locus
  6q26
• Discovery year
  1997-08-18
• Entrez gene record
  5071
• Pubmed identfication
  • 9560156
  • 9570960
• Classification
  • RBR E3 ubiquitin ligases
• VEGA ID
  OTTHUMG00000015970
• Locus Specific Databases
  • Global Variome shared LOVD

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Product images

Similar products