Recombinant Human NEDD8-Conjugating Enzyme UBC12/UBE2M

  • Catalog number
    CG49-50
  • Price
    Please ask
  • Size
    50 ug
  • Description
    Recombinant Human Ubiquitin-conjugating Enzyme E2M is produced by our E.coli expression system and the target gene encoding Met1-Lys183 is expressed.
  • Species reactivity
    Human
  • Origin
    Escherichia coli
  • Peptide sequence
    MIKLFSLKQQKKEEESAGGTKGSSKKASAAQLRIQKDINELNLPKTCDISFSDPDDLLNFKLVICPDEGFYKSGKFVFSFKVGQGYPHDPPKVKCETMVYHPNIDLEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAAEVLQNNRRLFEQNVQRSMRGGYIGSTYFERCLK
  • Estimated molecular weight
    20,9 kDa
  • Protein purity
    Greater than 95% as determined by reducing SDS-PAGE.
  • Endotoxin level
    Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
  • Shipping condition
    Dry ice/ice packs
  • Package form
    Supplied as a 0.2 µm filtered solution of 50mM HEPES,pH 7.5,2mM DTT,150mM NaCl,10%glycerol .
  • Storage conditions
    Store at below -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
  • Reconstitution conditions
    See included datasheet or contact us for more information.
  • UniProt number
    P61081
  • Additional description
    Enzymes are cleaving the substrate. If the substrate is DNA they are called restriction enzymes. Activating enzymes will cut off the domain that is biological active to become functional.
  • Properties
    Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Gene symbol
    NEDD8-MDP1, UBE2M, NEDD8
  • Short name
    Recombinant NEDD8-Conjugating Enzyme UBC12/UBE2M
  • Technique
    Recombinant, Enzyme, enzymes, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Species
    Human, Humans
  • Alternative name
    Human UBE2M/Ubc12
  • Alternative technique
    rec, enzymes
Gene info
Gene info
  • Identity
  • Gene
  • Long gene name
    ubiquitin conjugating enzyme E2 M
  • Synonyms gene name
    • ubiquitin-conjugating enzyme E2M (homologous to yeast UBC12)
    • ubiquitin-conjugating enzyme E2M (UBC12 homolog, yeast)
    • ubiquitin-conjugating enzyme E2M
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    1999-01-22
  • Entrez gene record
  • Pubmed identfication
  • RefSeq identity
  • Classification
    • Ubiquitin conjugating enzymes E2
  • VEGA ID
Gene info
  • Identity
  • Gene
  • Long gene name
    NEDD8 ubiquitin like modifier
  • Synonyms gene name
    • neural precursor cell expressed, developmentally down-regulated 8
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    1994-01-21
  • Entrez gene record
  • Pubmed identfication
  • RefSeq identity
  • VEGA ID
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee