Recombinant Human Natural Killer G2D/NKG2D/CD314/KLRK1 (N-Fc)

  • Catalog number
    CU41-50
  • Price
    Please ask
  • Size
    50 ug
  • Description
    Recombinant Human Natural Killer G2D is produced by our Mammalian expression system and the target gene encoding Phe78-Val216 is expressed with a Fc tag at the N-terminus.
  • Species reactivity
    Human
  • Origin
    Human cells
  • Peptide sequence
    GSGSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKIEGRFLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSTPNTYICMQRTV
  • Estimated molecular weight
    42,4 kDa
  • Protein purity
    Greater than 95% as determined by reducing SDS-PAGE.
  • Endotoxin level
    Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
  • Shipping condition
    Ambient/Room Temperature
  • Package form
    Lyophilized from a 0.2 µm filtered solution of PBS, pH7.4.
  • Storage conditions
    Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
  • Reconstitution conditions
    See included datasheet or contact us for more information.
  • UniProt number
    P26718
  • Properties
    Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Gene symbol
    KLRK1, KLRC4-KLRK1, KLRK1-AS1
  • Short name
    Recombinant Natural Killer G2D/NKG2D/CD314/KLRK1 (N-Fc)
  • Technique
    Recombinant, FC, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Species
    Human, Humans
  • Alternative name
    Recombinant Human NKG2D (N-Fc)
  • Alternative technique
    rec
  • Alternative to gene target
    NKG2-D type II integral membrane protein, CD314 and D12S2489E and KLR and NKG2-D and NKG2D, KLRK1 and IDBG-546188 and ENSG00000255819 and 100528032,22914, multiple
Gene info
  • Identity
  • Gene
  • Long gene name
    killer cell lectin like receptor K1
  • Synonyms gene
  • Synonyms gene name
    • DNA segment on chromosome 12 (unique) 2489 expressed sequence
    • killer cell lectin-like receptor subfamily K, member 1
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    2003-12-12
  • Entrez gene record
  • Pubmed identfication
  • RefSeq identity
  • Classification
    • Killer cell lectin like receptors
    • C-type lectin domain containing
    • CD molecules
  • VEGA ID
Gene info
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee