Recombinant Human Natural Killer Cell Receptor 2B4/SLAMF4/CD244 (C-6His)

• Catalog number
  CS61-50
• Price
  Please ask
• Size
  50 ug

• Description
  Recombinant Human Natural Killer Cell Receptor 2B4 is produced by our Mammalian expression system and the target gene encoding Cys22-Arg221 is expressed with a 6His tag at the C-terminus.
• Species reactivity
  Human
• Origin
  Human cells
• Peptide sequence
  CQGSADHVVSISGVPLQLQPNSIQTKVDSIAWKKLLPSQNGFHHILKWENGSLPSNTSNDRFSFIVKNLSLLIKAAQQQDSGLYCLEVTSISGKVQTATFQVFVFDKVEKPRLQGQGKILDRGRCQVALSCLVSRDGNVSYAWYRGSKLIQTAGNLTYLDEEVDINGTHTYTCNVSNPVSWESHTLNLTQDCQNAHQEFRHHHHHH
• Estimated molecular weight
  23,1 kDa
• Protein purity
  Greater than 95% as determined by reducing SDS-PAGE.
• Endotoxin level
  Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Shipping condition
  Ambient/Room Temperature
• Package form
  Lyophilized from a 0.2 µm filtered solution of PBS, pH7.4.
• Storage conditions
  Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
• Reconstitution conditions
  See included datasheet or contact us for more information.
• UniProt number
  Q9BZW8-2
• Other related products
• Additional description
  For cells, cell lines and tissues in culture till half confluency. The receptors are ligand binding factors of type 1, 2 or 3 and protein-molecules that receive chemical-signals from outside a cell. When such chemical-signals couple or bind to a receptor, they cause some form of cellular/tissue-response, e.g. a change in the electrical-activity of a cell. In this sense, am olfactory receptor is a protein-molecule that recognizes and responds to endogenous-chemical signals, chemokinesor cytokines e.g. an acetylcholine-receptor recognizes and responds to its endogenous-ligand, acetylcholine. However, sometimes in pharmacology, the term is also used to include other proteins that are drug-targets, such as enzymes, transporters and ion-channels.
• Properties
  Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  Natural   Killer   Receptor   2B4/SLAMF4/CD244   C-6His  
• Gene symbol
  CD244, GSTT1-AS1
• Short name
  Recombinant Natural Killer Receptor 2B4/SLAMF4/CD244 (C-6His)
• Technique
  Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Species
  Human, Humans
• Alternative name
  Recombinant Human 2B4 (C-6His)
• Alternative technique
  rec
• Alternative to gene target
  CD244 molecule, natural killer cell receptor 2B4, CD244 and IDBG-104114 and ENSG00000122223 and 51744, protein binding, Cell surfaces, Cd244 and IDBG-204694 and ENSMUSG00000004709 and 18106, CD244 and IDBG-630400 and ENSBTAG00000002951 and 513468
• Tissue
  cell

Gene info

• Identity
  HGNC:18171
• Gene
  CD244
• Long gene name
  CD244 molecule
• Synonyms gene name
  • natural killer cell receptor 2B4
  • CD244 natural killer cell receptor 2B4
  • CD244 molecule, natural killer cell receptor 2B4
• Synonyms
  • 2B4
  • NAIL
  • NKR2B4
  • Nmrk
  • SLAMF4
• GenBank acession
  • AF105261
• Locus
  1q23.3
• Discovery year
  2003-10-23
• Entrez gene record
  51744
• Pubmed identfication
  • 3772297
  • 10458320
• RefSeq identity
  • NM_016382
• Classification
  • Ig-like cell adhesion molecule family
  • Immunoglobulin like domain containing
  • CD molecules
• VEGA ID
  OTTHUMG00000028606

Gene info

• Identity
  HGNC:51839
• Gene
  GSTT1-AS1
• Long gene name
  GSTT1 antisense RNA 1
• Synonyms
  • lncRNA-AS-GSTT1(1-72)
  • lncRNA-CD244
  • lncRNA-BC050410
• GenBank acession
  • KI270879
  • BC050410
• Locus
  22q11.23 alternate reference locus
• Discovery year
  2015-08-05
• Entrez gene record
  106099130
• Pubmed identfication
  • 26150504
• RefSeq identity
  • NR_132348
• Classification
  • Antisense RNAs

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Product images

Similar products