Recombinant Human Matrix Metalloproteinase-9/MMP-9 (C-6His)

  • Catalog number
    CI71-500
  • Price
    Please ask
  • Size
    500 ug
  • Description
    Recombinant Human Matrix metalloproteinase-9 is produced by our Mammalian expression system and the target gene encoding Ala19-Asp707 is expressed with a 6His tag at the C-terminus.
  • Species reactivity
    Human
  • Origin
    Human cells
  • Peptide sequence
    AAPRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEMRGESKSLGPALLLLQKQLSLPETGELDSATLKAMRTPRCGVPDLGRFQTFEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTRFGNADGAACHFPFIFEGRSYSACTTDGRSDGLPWCSTTANYDTDDRFGFCPSERLYTRDGNADGKPCQFPFIFQGQSYSACTTDGRSDGYRWCATTANYDRDKLFGFCPTRADSTVMGGNSAGELCVFPFTFLGKEYSTCTSEGRGDGRLWCATTSNFDSDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMYPMYRFTEGPPLHKDDVNGIRHLYGPRPEPEPRPPTTTTPQPTAPPTVCPTGPPTVHPSERPTAGPTGPPSAGPTGPPTAGPSTATTVPLSPVDDACNVNIFDAIAEIGNQLYLFKDGKYWRFSEGRGSRPQGPFLIADKWPALPRKLDSVFEEPLSKKLFFFSGRQVWVYTGASVLGPRRLDKLGLGADVAQVTGALRSGRGKMLLFSGRRLWRFDVKAQMVDPRSASEVDRMFPGVPLDTHDVFQYREKAYFCQDRFYWRVSSRSELNQVDQVGYVTYDILQCPEDVDHHHHHH
  • Estimated molecular weight
    77,4 kDa
  • Protein purity
    Greater than 95% as determined by reducing SDS-PAGE.
  • Endotoxin level
    Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
  • Shipping condition
    Dry Ice/ice packs
  • Package form
    Supplied as a 0.2 µm filtered solution of 20mM TrisHCl, 2mM CaCl2, 150mM NaCl, 0.05% Brij35(w/v), pH 7.5.
  • Storage conditions
    Store at below -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
  • Reconstitution conditions
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
  • UniProt number
    P14780
  • Properties
    Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Gene symbol
    MMP9, MMP14, MMP24, MMP28, RNU6-9, PIRC47, PIRC38, PIRC43, PIRC45
  • Short name
    Recombinant Matrix Metalloproteinase-9/MMP-9 (C-6His)
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Species
    Human, Humans
  • Alternative name
    Human MMP-9(C-6His)
  • Alternative technique
    rec
Gene info
  • Identity
  • Gene
  • Long gene name
    matrix metallopeptidase 9
  • Synonyms gene
  • Synonyms gene name
    • matrix metalloproteinase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase)
  • Locus
  • Discovery year
    1990-03-14
  • Entrez gene record
  • Pubmed identfication
  • Classification
    • M10 matrix metallopeptidases
  • VEGA ID
Gene info
Gene info
Gene info
Gene info
Gene info
  • Identity
  • Gene
  • Long gene name
    piwi-interacting RNA cluster 47
  • Locus
    9
  • Discovery year
    2009-11-05
  • Entrez gene record
  • Pubmed identfication
  • Classification
    • Piwi-interacting RNA clusters
Gene info
  • Identity
  • Gene
  • Long gene name
    piwi-interacting RNA cluster 38
  • Locus
    9
  • Discovery year
    2009-11-05
  • Entrez gene record
  • Pubmed identfication
  • Classification
    • Piwi-interacting RNA clusters
Gene info
  • Identity
  • Gene
  • Long gene name
    piwi-interacting RNA cluster 43
  • Locus
    9
  • Discovery year
    2009-11-05
  • Entrez gene record
  • Pubmed identfication
  • Classification
    • Piwi-interacting RNA clusters
Gene info
  • Identity
  • Gene
  • Long gene name
    piwi-interacting RNA cluster 45
  • Locus
    9
  • Discovery year
    2009-11-05
  • Entrez gene record
  • Pubmed identfication
  • Classification
    • Piwi-interacting RNA clusters
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee