Recombinant Human Induced Myeloid Leukemia Cell Differentiation Protein Mcl-1/MCL1L (N-6His)

• Catalog number
  CR23-1000
• Price
  Please ask
• Size
  1 mg

• Description
  Recombinant Human Bcl-2-related protein Mcl-1 is produced by our E.coli expression system and the target gene encoding Met1-Gly327 is expressed with a 6His tag at the N-terminus.
• Species reactivity
  Human
• Origin
  Escherichia coli
• Peptide sequence
  MNHKVHHHHHHMFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEKEASARREIGGGEAGAVIGGSAGASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVEDLEGG
• Estimated molecular weight
  36,5 kDa
• Protein purity
  Greater than 95% as determined by reducing SDS-PAGE.
• Endotoxin level
  Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Shipping condition
  Dry Ice/ice packs
• Package form
  Supplied as a 0.2 µm filtered solution of 20mM Tris, 200mM NaCl, 2mM DTT, 20% glycerol, pH8.0.
• Storage conditions
  Store at below -20°C, stable for 6 months after receipt.Please minimize freeze-thaw cycles.
• Reconstitution conditions
  See included datasheet or contact us for more information.
• UniProt number
  Q07820
• Other related products
• Additional description
  For cells, cell lines and tissues in culture till half confluency. Induced protein genes, factors or kinases, increase the production of (an enzyme or other protein) at the level of genetic transcription.
• Properties
  Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  Myeloid   Leukemia   Differentiation   Protein   Mcl-1/MCL1L   N-6His  
• Short name
  Recombinant Myeloid Leukemia Differentiation Protein Mcl-1/MCL1L (N-6His)
• Technique
  Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Species
  Human, Humans
• Alternative name
  Recombinant Human MCL1L(N-6His)
• Alternative technique
  rec
• Tissue
  cell
• Virus
  leukemia

MeSH Data

• Name
  Leukemia, Experimental
• Concept
  Scope note: Leukemia induced experimentally in animals by exposure to leukemogenic agents, such as VIRUSES; RADIATION; or by TRANSPLANTATION of leukemic tissues.
• Tree numbers
  • C04.557.337.372
  • C04.619.531
  • E05.598.500.496.500
• Qualifiers
  diagnosis, parasitology, immunology, microbiology, diagnostic imaging, physiopathology, rehabilitation, enzymology, etiology, mortality, epidemiology, blood, cerebrospinal fluid, chemically induced, congenital, diet therapy, drug therapy, therapy, psychology, urine, virology, history, classification, economics, embryology, genetics, nursing, radiotherapy, ethnology, prevention & control, pathology, metabolism, complications, surgery

Product images

Similar products