Recombinant Human Fructose-1,6-Bisphosphatase 1/FBPase 1 (E. coli, C-6His)
-
Catalog number
C139-50
-
Price
Please ask
-
Size
50 ug
-
-
Description
Recombinant Human FBPase 1 is produced by our E.coli expression system and the target gene encoding Ala2-Gln338 is expressed with a 6His tag at the C-terminus.
-
Species reactivity
Human
-
Origin
Escherichia coli
-
Peptide sequence
ADQAPFDTDVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAVRKAGIAHLYGIAGSTNVTGDQVKKLDVLSNDLVMNMLKSSFATCVLVSEEDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYARDFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVYGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTGKEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHSAQVEHHHHHH
-
Estimated molecular weight
37,89 kDa
-
Protein purity
Greater than 95% as determined by reducing SDS-PAGE.
-
Endotoxin level
Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
-
Shipping condition
Dry ice/ice packs
-
Package form
Supplied as a 0.2 µm filtered solution of 20mM TrisHCl, 200mM NaCl, 1mM DTT, 1mM EDTA, 20% Glycerol, pH 8.0.
-
Storage conditions
Store at below -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
-
Reconstitution conditions
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
-
UniProt number
P09467
-
-
Properties
Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
-
Source
Recombinants or rec. proteins
-
Group
recombinants
-
Gene target
-
Short name
Recombinant Fructose-1 6-Bisphosphatase 1/FBPase 1 ( , C-6His)
-
Technique
Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
-
Host
e. coli, Escherichia coli, Recombination of bioactive proteins and longer peptides in Escherichia Coli is done often with His tagging. novo supplies Rec. E. Coli affinity purified or tag purified antigens in 1 quantities or bulk volumes on request.
-
Species
E. coli, E. coli, Humans
-
Alternative name
Human Fructose-1,6-Bisphosphatase 1/FBPase 1(E.coli,C-6His)
-
Alternative technique
rec, escherichia
-
MeSH Data
-
Name
-
Concept
Scope note:
The initial culturing of cells derived directly from fresh TISSUES.
-
Tree numbers
- E01.370.225.500.223.500
- E05.200.500.265.500
- E05.242.223.500
- E05.481.500.249.500
-
Qualifiers
ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products