Recombinant Human Cytotoxic T-Lymphocyte Protein 4/CTLA-4/CD152 (C-Fc)

  • Catalog number
    CI31-500
  • Price
    Please ask
  • Size
    500 ug
  • Description
    Recombinant Human Cytotoxic T-lymphocyte protein 4 is produced by our Mammalian expression system and the target gene encoding Lys36-Asp161 is expressed with a Fc tag at the C-terminus.
  • Species reactivity
    Human
  • Origin
    Human cells
  • Peptide sequence
    KAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDQEPKSSDKTHTSPPSPAPELLGGSSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
  • Estimated molecular weight
    41,5 kDa
  • Protein purity
    Greater than 95% as determined by reducing SDS-PAGE.
  • Endotoxin level
    Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
  • Shipping condition
    Ambient/Room Temperature
  • Package form
    Lyophilized from a 0.2 µm filtered solution of PBS, pH7.4.
  • Storage conditions
    Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
  • Reconstitution conditions
    See included datasheet or contact us for more information.
  • UniProt number
    P16410
  • Properties
    Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Gene symbol
    CTLA4, MIR1302-4, PIRC18, PIRC16, SNORD114-4, MIR941-4, IGKV2OR2-4, ANKRD20A12P
  • Short name
    Recombinant Cytotoxic T-Lymphocyte Protein 4/CTLA-4/CD152 (C-Fc)
  • Technique
    Recombinant, FC, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Species
    Human, Humans
  • Alternative name
    Recombinant Human CTLA4(C-Fc)
  • Alternative technique
    rec
  • Tissue
    lymphocyte
Gene info
Gene info
Gene info
  • Identity
  • Gene
  • Long gene name
    piwi-interacting RNA cluster 18
  • Locus
    4
  • Discovery year
    2009-11-05
  • Entrez gene record
  • Pubmed identfication
  • Classification
    • Piwi-interacting RNA clusters
Gene info
  • Identity
  • Gene
  • Long gene name
    piwi-interacting RNA cluster 16
  • Locus
    4
  • Discovery year
    2009-11-05
  • Entrez gene record
  • Pubmed identfication
  • Classification
    • Piwi-interacting RNA clusters
Gene info
Gene info
Gene info
  • Identity
  • Gene
  • Long gene name
    immunoglobulin kappa variable 2/OR2-4 (pseudogene)
  • Synonyms gene name
    • immunoglobulin kappa variable 2/OR2-4
    • immunoglobulin kappa variable 2/OR2-4 pseudogene
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    2000-04-18
  • Entrez gene record
  • Pubmed identfication
  • Classification
    • Immunoglobulin kappa (IGK) orphons
Gene info
  • Identity
  • Gene
  • Long gene name
    ankyrin repeat domain 20 family member A12, pseudogene
  • Synonyms gene name
    • ankyrin repeat domain 20 family, member A12, pseudogene
  • Locus
    4
  • Discovery year
    2011-11-23
  • Entrez gene record
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee