Recombinant Human Cysteine Dioxygenase Type 1/CDO1 (N-6His)

• Catalog number
  CE18-10
• Price
  Please ask
• Size
  10 ug

• Description
  Recombinant Human CDO1 is produced by our E.coli expression system and the target gene encoding Met1-Asn200 is expressed with a 6His tag at the N-terminus.
• Species reactivity
  Human
• Origin
  Escherichia coli
• Peptide sequence
  MGSSHHHHHHSSGLVPRGSHMEQTEVLKPRTLADLIRILHQLFAGDEVNVEEVQAIMEAYESDPTEWAMYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTNSHCFLKMLQGNLKETLFAWPDKKSNEMVKKSERVLRENQCAYINDSVGLHRVENISHTEPAVSLHLYSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTPNATSGSLENN
• Estimated molecular weight
  25,1 kDa
• Protein purity
  Greater than 95% as determined by reducing SDS-PAGE.
• Endotoxin level
  Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Shipping condition
  Dry ice/ice packs
• Package form
  Supplied as a 0.2 µm filtered solution of 20mM TrisHCl, 1mM DTT, 10% Glycerol, pH 8.0.
• Storage conditions
  Store at below -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
• Reconstitution conditions
  See included datasheet or contact us for more information.
• UniProt number
  Q16878
• Other related products
• Gene
  Cys or cysteines ChEMBL54943
• Properties
  Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  Cysteine   Dioxygenase   1/CDO1   N-6His  
• Gene symbol
  CDO1
• Short name
  Recombinant Cysteine Dioxygenase 1/CDO1 (N-6His)
• Technique
  Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Species
  Human, Humans
• Alternative name
  Human Cysteine Dioxygenase Type 1/CDO1(N-6His)
• Alternative technique
  rec

Gene info

• Identity
  HGNC:1795
• Gene
  CDO1
• Long gene name
  cysteine dioxygenase type 1
• Synonyms gene name
  • cysteine dioxygenase, type I
• Locus
  5q22.3
• Discovery year
  1996-09-13
• Entrez gene record
  1036
• Pubmed identfication
  • 7524679
• RefSeq identity
  • NM_001801
• VEGA ID
  OTTHUMG00000128891

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Product images

Similar products