Recombinant Human Cyclophilin E/PPIase E/PPIE (N-6His)

• Catalog number
  C216-50
• Price
  Please ask
• Size
  50 ug

• Description
  Recombinant Human Cyclophilin E is produced by our E.coli expression system and the target gene encoding Met1-Val301 is expressed with a 6His tag at the N-terminus.
• Species reactivity
  Human
• Origin
  Escherichia coli
• Peptide sequence
  MGSSHHHHHHSSGLVPRGSHMATTKRVLYVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAEDAAAAIDNMNESELFGRTIRVNLAKPMRIKEGSSRPVWSDDDWLKKFSGKTLEENKEEEGSEPPKAETQEGEPIAKKARSNPQVYMDIKIGNKPAGRIQMLLRSDVVPMTAENFRCLCTHEKGFGFKGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSGPNTNGSQFFLTCDKTDWLDGKHVVFGEVTEGLDVLRQIEAQGSKDGKPKQKVIIADCGEYV
• Estimated molecular weight
  35,6 kDa
• Protein purity
  Greater than 95% as determined by reducing SDS-PAGE.
• Endotoxin level
  Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Shipping condition
  Dry ice/ice packs
• Package form
  Supplied as a 0.2 µm filtered solution of 20mM TrisHCl, pH 8.0.
• Storage conditions
  Store at below -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
• Reconstitution conditions
  Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
• UniProt number
  Q9UNP9
• Other related products
• Properties
  Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  Cyclophilin   E/PPIase   E/PPIE   N-6His  
• Gene symbol
  PPIE
• Short name
  Recombinant Cyclophilin E/PPIase E/PPIE (N-6His)
• Technique
  Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Species
  Human, Humans
• Alternative name
  Human Cyclophilin E/PPIase E/PPIE(N-6His)
• Alternative technique
  rec
• Alternative to gene target
  peptidylprolyl isomerase E (cyclophilin E), CYP-33 and CYP33, PPIE and IDBG-96746 and ENSG00000084072 and 10450, poly(A) RNA binding, nuclei, Ppie and IDBG-184920 and ENSMUSG00000028651 and 56031, BT.21742 and IDBG-640866 and ENSBTAG00000047314 and 100296550,787681

Gene info

• Identity
  HGNC:9258
• Gene
  PPIE
• Long gene name
  peptidylprolyl isomerase E
• Synonyms
  • CyP-33
  • MGC3736
  • MGC111222
• Synonyms name
  • peptidyl-prolyl cis-trans isomerase E
  • cyclophilin 33
  • cyclophilin E
  • PPIase E
  • rotamase E
  • peptidylprolyl isomerase E, isoform 1
• GenBank acession
  • AF042385
• Locus
  1p34.2
• Discovery year
  1999-07-07
• Entrez gene record
  10450
• Pubmed identfication
  • 9747881
• RefSeq identity
  • NM_006112
• Classification
  • Cyclophilin peptidylprolyl isomerases
  • Spliceosomal C complex
  • Spliceosomal B complex
  • Spliceosomal Bact complex
  • Spliceosomal P complex
  • RNA binding motif containing
• VEGA ID
  OTTHUMG00000009248
• Locus Specific Databases
  • LRG_1053

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Product images

Similar products