Recombinant Human CD226 Antigen/DNAM-1/CD226 (C-Fc)

  • Catalog number
    CS90-10
  • Price
    Please ask
  • Size
    10 ug
  • Description
    Recombinant Human CD226 Antigen is produced by our Mammalian expression system and the target gene encoding Glu19-Asn247 is expressed with a Fc tag at the C-terminus.
  • Species reactivity
    Human
  • Origin
    Human cells
  • Peptide sequence
    EEVLWHTSVPFAENMSLECVYPSMGILTQVEWFKIGTQQDSIAIFSPTHGMVIRKPYAERVYFLNSTMASNNMTLFFRNASEDDVGYYSCSLYTYPQGTWQKVIQVVQSDSFEAAVPSNSHIVSEPGKNVTLTCQPQMTWPVQAVRWEKIQPRQIDLLTYCNLVHGRNFTSKFPRQIVSNCSHGRWSVIVIPDVTVSDSGLYRCYLQASAGENETFVMRLTVAEGKTDNHIEGRMDPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
  • Estimated molecular weight
    52.8
  • Protein purity
    Greater than 95% as determined by reducing SDS-PAGE.
  • Endotoxin level
    Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
  • Shipping condition
    Ambient/Room Temperature
  • Package form
    Lyophilized from a 0.2 µm filtered solution of PBS, pH7.4.
  • Storage conditions
    Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
  • Reconstitution conditions
    See included datasheet or contact us for more information.
  • UniProt number
    Q15762
  • Additional description
    Antigens are peptides or recombinant or native dependent on the production method.
  • Properties
    Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Gene symbol
    CD226, IGHVII-1-1, MIR1-1, TRUND-NNN8-1, TRUND-NNN7-1, IGKV1OR2-1, MIR1289-1, MIR101-1, MIR16-1
  • Short name
    Recombinant CD226 Antigen/DNAM-1/CD226 (C-Fc)
  • Technique
    Recombinant, antigen, FC, antigenes, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Species
    Human, Humans
  • Alternative name
    Recombinant Human DNAM-1 (C-Fc)
  • Alternative technique
    rec, antigenes
  • Alternative to gene target
    CD226 molecule, DNAM-1 and DNAM1 and PTA1 and TLiSA1, CD226 and IDBG-4779 and ENSG00000150637 and 10666, cell adhesion molecule binding, Cell surfaces, Cd226 and IDBG-163478 and ENSMUSG00000034028 and 225825, CD226 and IDBG-643547 and ENSBTAG00000009266 and 615496
Gene info
Gene info
  • Identity
  • Gene
  • Long gene name
    immunoglobulin heavy variable (II)-1-1 (pseudogene)
  • Synonyms gene name
    • immunoglobulin heavy variable (II)-1-1
    • immunoglobulin heavy variable (II)-1-1 pseudogene
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    2000-04-17
  • Entrez gene record
  • RefSeq identity
  • Classification
    • Immunoglobulin heavy locus at 14q32.33
  • VEGA ID
Gene info
Gene info
  • Identity
  • Gene
  • Long gene name
    tRNA-undetermined (NNN) 8-1
  • Synonyms gene name
    • transfer RNA-undetermined (NNN) 8-1
  • GenBank acession
  • Locus
    1
  • Discovery year
    2014-06-20
  • Entrez gene record
  • Pubmed identfication
Gene info
  • Identity
  • Gene
  • Long gene name
    tRNA-undetermined (NNN) 7-1
  • Synonyms gene name
    • transfer RNA-undetermined (NNN) 7-1
  • GenBank acession
  • Locus
    1
  • Discovery year
    2014-06-20
  • Entrez gene record
  • Pubmed identfication
Gene info
  • Identity
  • Gene
  • Long gene name
    immunoglobulin kappa variable 1/OR2-1 (pseudogene)
  • Synonyms gene
  • Synonyms gene name
    • immunoglobulin kappa variable 1/OR-1
    • immunoglobulin kappa variable 1/OR-1 pseudogene
    • immunoglobulin kappa variable 1/OR-1 (pseudogene)
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    2000-04-18
  • Entrez gene record
  • Pubmed identfication
  • Classification
    • Immunoglobulin kappa (IGK) orphons
  • VEGA ID
Gene info
Gene info
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
  • Tree numbers
    • E05.196.401.143
    • E05.301.300.096
    • E05.478.566.320.200
    • E05.601.262
    • E05.601.470.320.200
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee