-
Description
Recombinant Human Brain-type Natriuretic Peptide is produced by our E.coli expression system and the target gene encoding His27-Arg102 is expressed with a 6His, Flag tag at the N-terminus.
-
Species reactivity
Human
-
Origin
Escherichia coli
-
Peptide sequence
MNHKVHHHHHHMDYKDDDDKHPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPR
-
Estimated molecular weight
11 kDa
-
Protein purity
Greater than 95% as determined by reducing SDS-PAGE.
-
Endotoxin level
Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
-
Shipping condition
Ambient/Room Temperature
-
Package form
Lyophilized from a 0.2 µm filtered solution of PBS,pH7.4.
-
Storage conditions
Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
-
Reconstitution conditions
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
-
UniProt number
P16860
-
-
Properties
An anti-flag tag (FLAG fusion protein) is use to detect a FLAG-tag, or FLAG octapeptide, or FLAG epitope that is a polypeptide protein tag that can be added to a protein using recombinant DNA. This FLAG-tags have the sequence DYKDDDDK motiv. These tags are very useful to do protein purification by affinity chromatography. Also separation of recombinant, overexpressed proteins from cell lysates is done by FLAG go HIS tags. FLAGS are also used in the isolation of protein complexes with multiple subunits, because its mild purification procedure tends not to disrupt such complexes. It has been used to enrich proteins of height purity and quality to see the 3D crystal structure with x-ray. Suitable for in vivo use in cells. For electrophorese protein detection rabbit polyclonals anti Flag conjugation are the most suited antibodies. Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
-
Conjugation
Flag
-
Additional description
Peptides short amino acid chains or epitopes or blocking antagonists. The shortest peptides are dipeptides, consisting of 2 amino acids joined by a single peptide bond, followed by tripeptides, tetra peptides, ... till polypeptides that are long, continuous, and unbranched synthetic peptide chains. These biological oligomers and polymers can be Solid-phase peptide synthesis (SPPS), or in continue produced for custom peptide synthesis projects. The High-efficiency solid phase peptide synthesis (HE-SPPS) is give very low production costs.
-
Source
Recombinants or rec. proteins
-
Group
recombinants
