Recombinant Human Bone Marrow Stromal Antigen 2/BST2/Tetherin/CD317 (C-6His)

#

• Catalog number
  CA75-10
• Price:

  Please ask

  Ask for price
• Size
  10 ug

# #

• Description
  Recombinant Human Bone Marrow Stromal Antigen 2 is produced by our Mammalian expression system and the target gene encoding Asn49-Ser161 is expressed with a 6His tag at the C-terminus.
• Species reactivity
  Human
• Origin
  Human cells
• Peptide sequence
  NSEACRDGLRAVMECRNVTHLLQQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIADKKYYPSSQDSSVDHHHHHH
• Estimated molecular weight
  13,67 kDa
• Protein purity
  Greater than 95% as determined by reducing SDS-PAGE.
• Endotoxin level
  Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Shipping condition
  Ambient/Room Temperature
• Package form
  Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4.
• Storage conditions
  Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
• Reconstitution conditions
  Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
• UniProt number
  Q10589
• Other related products
• Additional description
  Antigens are peptides or recombinant or native dependent on the production method.
• Properties
  Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
• Source
  Recombinants or rec. proteins
• Group
  recombinants

#

• Gene target
  Bone   Marrow   Stromal   2/BST2/Tetherin/CD317   C-6His  
• Gene symbol
  BST2
• Short name
  Recombinant Bone Marrow Stromal Antigen 2/BST2/Tetherin/CD317 (C-6His)
• Technique
  Recombinant, antigen, antigenes, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Species
  Human, Humans
• Alternative name
  Human BST2/Tetherin/CD137(C-6His)
• Alternative technique
  rec, antigenes
• Alternative to gene target
  bone marrow stromal cell antigen 2, CD317 and TETHERIN, BST2 and IDBG-36619 and ENSG00000130303 and 684, poly(A) RNA binding, Cell surfaces, Bst2 and IDBG-165924 and ENSMUSG00000046718 and 69550
• Tissue
  bone, marrow

Gene info

• Identity
  HGNC:1119
• Gene
  BST2
• Long gene name
  bone marrow stromal cell antigen 2
• Synonyms
  • CD317
  • tetherin
  • BST-2
  • HM1.24
• Synonyms name
  • antiviral factor tetherin
• Locus
  19p13.11
• Discovery year
  1994-11-17
• Entrez gene record
  684
• Pubmed identfication
  • 7607676
• RefSeq identity
  • NM_004335
• Classification
  • CD molecules
• VEGA ID
  OTTHUMG00000191770

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Product images

Similar products