Recombinant Human B7-2/CD86 (C-6His)

#
  • Catalog number
    C404-500
  • Price:

    Please ask

    Ask for price
  • Size
    500 ug
# #
  • Description
    Recombinant Human CD86 is produced by our Mammalian expression system and the target gene encoding Ala24-Pro247 is expressed with a 6His tag at the C-terminus.
  • Species reactivity
    Human
  • Origin
    Human cells
  • Peptide sequence
    APLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTIEYDGIMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQPPPDHIPVDHHHHHH
  • Estimated molecular weight
    26,69 kDa
  • Protein purity
    Greater than 95% as determined by reducing SDS-PAGE.
  • Endotoxin level
    Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
  • Shipping condition
    Ambient/Room Temperature
  • Package form
    Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
  • Storage conditions
    Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
  • Reconstitution conditions
    See included datasheet or contact us for more information.
  • UniProt number
    P42081
  • Properties
    Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
#
  • Gene target
  • Gene symbol
    CD86, CD276, HHLA2, RNY4P2, LRRC23, PCDHGB7, NCR3LG1, CD274, TLX1NB, CD80
  • Short name
    Recombinant B7-2/CD86 (C-6His)
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Species
    Human, Humans
  • Alternative name
    Human CD86/B7-2(C-6His)
  • Alternative technique
    rec
  • Alternative to gene target
    CD86 molecule, B7-2 and B7.2 and B70 and CD28LG2 and LAB72, CD86 and IDBG-52336 and ENSG00000114013 and 942, coreceptor activity, Cell surfaces, Cd86 and IDBG-158071 and ENSMUSG00000022901 and 12524, CD86 and IDBG-633264 and ENSBTAG00000013118 and 414345
Gene info
Gene info
Gene info
Gene info
  • Identity
  • Gene
  • Long gene name
    RNY4 pseudogene 2
  • Synonyms gene name
    • RNA, Y4 small cytoplasmic (associated with Ro protein) pseudogene 2
    • RNA, Ro-associated Y4 pseudogene 2
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    1993-08-25
  • Entrez gene record
  • RefSeq identity
Gene info
Gene info
Gene info
Gene info
Gene info
Gene info
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee