Recombinant Human B- and T-Lymphocyte Attenuator/BTLA/CD272 (C-6His)

• Catalog number
  C563-50
• Price
  Please ask
• Size
  50 ug

• Description
  Recombinant Human BTLA is produced by our Mammalian expression system and the target gene encoding Lys31-Leu150 is expressed with a 6His tag at the C-terminus.
• Species reactivity
  Human
• Origin
  Human cells
• Peptide sequence
  KESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTGKQNELSDTAGREINLVDHHHHHH
• Estimated molecular weight
  14,79 kDa
• Protein purity
  Greater than 95% as determined by reducing SDS-PAGE.
• Endotoxin level
  Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Shipping condition
  Ambient/Room Temperature
• Package form
  Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
• Storage conditions
  Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
• Reconstitution conditions
  Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
• UniProt number
  Q7Z6A9
• Other related products
• Properties
  Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  T-Lymphocyte   Attenuator/BTLA/CD272   C-6His  
• Gene symbol
  BTLA
• Short name
  Recombinant B- T-Lymphocyte Attenuator/BTLA/CD272 (C-6His)
• Technique
  Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Species
  Human, Humans
• Alternative name
  Human BTLA/CD272(C-6His)
• Alternative technique
  rec
• Alternative to gene target
  B and T lymphocyte associated, BTLA and IDBG-49858 and ENSG00000186265 and 151888, protein binding, Cell surfaces, Btla and IDBG-162900 and ENSMUSG00000052013 and 208154, BTLA and IDBG-632288 and ENSBTAG00000011871 and 531767
• Tissue
  lymphocyte

Gene info

• Identity
  HGNC:21087
• Gene
  BTLA
• Long gene name
  B and T lymphocyte associated
• Synonyms
  • BTLA1
  • CD272
• GenBank acession
  • AY293286
• Locus
  3q13.2
• Discovery year
  2003-08-20
• Entrez gene record
  151888
• Pubmed identfication
  • 12796776
• RefSeq identity
  • NM_181780
• Classification
  • Immunoglobulin like domain containing
  • CD molecules
• VEGA ID
  OTTHUMG00000159255

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Product images

Similar products