Recombinant Human Aldo-Keto Reductase 1C3/AKR1C3 (C-6His)

• Catalog number
  C985-500
• Price
  Please ask
• Size
  500 ug

• Description
  Recombinant Human Aldo-Keto Reductase 1C3 is produced by our Mammalian expression system and the target gene encoding Met1-Tyr323 is expressed with a 6His tag at the C-terminus.
• Species reactivity
  Human
• Origin
  Human cells
• Peptide sequence
  MDSKHQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSDEYVDHHHHHH
• Estimated molecular weight
  37,8 kDa
• Protein purity
  Greater than 95% as determined by reducing SDS-PAGE.
• Endotoxin level
  Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Shipping condition
  Ambient/Room Temperature
• Package form
  Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4.
• Storage conditions
  Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
• Reconstitution conditions
  Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
• UniProt number
  P42330
• Other related products
• Properties
  Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  Aldo-Keto   Reductase   1C3/AKR1C3   C-6His  
• Gene symbol
  AKR1C3
• Short name
  Recombinant Aldo-Keto Reductase 1C3/AKR1C3 (C-6His)
• Technique
  Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Species
  Human, Humans
• Alternative name
  Human Aldo-Keto Reductase 1C3/AKR1C3(C-6His)
• Alternative technique
  rec
• Alternative to gene target
  aldo-keto reductase family 1, member C3 (3-alpha hydroxysteroid dehydrogenase, type II), DD3 and DDX and HA1753 and HAKRB and HAKRe and hluPGFS and HSD17B5 and PGFS, AKR1C3 and IDBG-47964 and ENSG00000196139 and 8644, oxidoreductase activity, nuclei

Gene info

• Identity
  HGNC:386
• Gene
  AKR1C3
• Long gene name
  aldo-keto reductase family 1 member C3
• Synonyms gene
  • HSD17B5
• Synonyms gene name
  • hydroxysteroid (17-beta) dehydrogenase 5
  • aldo-keto reductase family 1, member C3 (3-alpha hydroxysteroid dehydrogenase, type II)
• Synonyms
  • KIAA0119
  • DDX
  • HAKRB
  • PGFS
• Synonyms name
  • dihydrodiol dehydrogenase X
  • prostaglandin F synthase
  • 3-alpha hydroxysteroid dehydrogenase, type II
• GenBank acession
  • L43839
• Locus
  10p15.1
• Discovery year
  1998-09-29
• Entrez gene record
  8644
• Pubmed identfication
  • 7650035
  • 9792917
• RefSeq identity
  • NM_003739
• Classification
  • Aldo-keto reductases
• VEGA ID
  OTTHUMG00000017585

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Product images

Similar products