Recombinant Human Aldo-Keto Reductase 1C2/AKR1C2

• Catalog number
  C295-10
• Price
  Please ask
• Size
  10 ug

• Description
  Recombinant Human Aldo-Keto Reductase 1C3 is produced by our E.coli expression system and the target gene encoding Met1-Tyr323 is expressed.
• Species reactivity
  Human
• Origin
  Escherichia coli
• Peptide sequence
  MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY
• Estimated molecular weight
  36,74 kDa
• Protein purity
  Greater than 95% as determined by reducing SDS-PAGE.
• Endotoxin level
  Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Shipping condition
  Dry Ice/ice packs
• Package form
  Supplied as a 0.2 µm filtered solution of 20mM TrisHCl, 100mM NaCl, 1mM DTT, pH 8.0.
• Storage conditions
  Store at below -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
• Reconstitution conditions
  Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
• UniProt number
  P52895
• Other related products
• Properties
  Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  Aldo-Keto   Reductase   1C2/AKR1C2  
• Gene symbol
  AKR1C2
• Short name
  Recombinant Aldo-Keto Reductase 1C2/AKR1C2
• Technique
  Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Species
  Human, Humans
• Alternative name
  Human Aldo-Keto Reductase 1C3/AKR1C2
• Alternative technique
  rec
• Alternative to gene target
  aldo-keto reductase family 1, member C2 (dihydrodiol dehydrogenase 2; bile acid binding protein; 3-alpha hydroxysteroid dehydrogenase, type III), AKR1C-pseudo and BABP and DD and DD2 and DDH2 and HAKRD and HBAB and MCDR2 and SRXY8 and TDD, AKR1C2 and IDBG-47297 and ENSG00000151632 and 1646, oxidoreductase activity, Cytoplasm

Gene info

• Identity
  HGNC:385
• Gene
  AKR1C2
• Long gene name
  aldo-keto reductase family 1 member C2
• Synonyms gene
  • DDH2
  • TDD
• Synonyms gene name
  • aldo-keto reductase family 1, member C2 (dihydrodiol dehydrogenase 2; bile acid binding protein; 3-alpha hydroxysteroid dehydrogenase, type III)
  • testicular 17,20-desmolase deficiency
• Synonyms
  • DD
  • BABP
  • DD2
  • HAKRD
  • MCDR2
• Synonyms name
  • dihydrodiol dehydrogenase 2; bile acid binding protein; 3-alpha hydroxysteroid dehydrogenase, type III
• GenBank acession
  • L32592
• Locus
  10p15.1
• Discovery year
  1994-09-14
• Entrez gene record
  1646
• Pubmed identfication
  • 9716498
  • 21802064
• RefSeq identity
  • NM_001354
• Classification
  • Aldo-keto reductases
• VEGA ID
  OTTHUMG00000017584

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Product images

Similar products