Recombinant Human 4-1BB Ligand/4-1BBL/TNFSF9/CD137L (N-Fc)

  • Catalog number
    CS18-10
  • Price
    Please ask
  • Size
    10 ug
  • Description
    Recombinant Human 4-1BB Ligand is produced by our Mammalian expression system and the target gene encoding Arg71-Glu254 is expressed with a Fc tag at the N-terminus.
  • Species reactivity
    Human
  • Origin
    Human cells
  • Peptide sequence
    MDPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKIEGRREGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE
  • Estimated molecular weight
    46.1
  • Protein purity
    Greater than 95% as determined by reducing SDS-PAGE.
  • Endotoxin level
    Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
  • Shipping condition
    Ambient/Room Temperature
  • Package form
    Lyophilized from a 0.2 µm filtered solution of PBS,pH7.4.
  • Storage conditions
    Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
  • Reconstitution conditions
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
  • UniProt number
    P41273
  • Properties
    Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
  • Additional description
    FAS ligand and other ligands are binding to the receptor for signaling pathways for example in apoptosis or JNK signaling. Receptor agonists are often tested for drug development.
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Gene symbol
    TNFSF9, TNFRSF9, MIR1302-4, PIRC18, PIRC16, SNORD114-4, MIR941-4, IGKV2OR2-4
  • Short name
    Recombinant 4-1BB Ligand/4-1BBL/TNFSF9/CD137L (N-Fc)
  • Technique
    Recombinant, FC, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Species
    Human, Humans
  • Alternative name
    Recombinant Human 4-1BBL (N-Fc)
  • Alternative technique
    rec
  • Alternative to gene target
    tumor necrosis factor (ligand) superfamily, member 9, 4-1BB-L and CD137L, TNFSF9 and IDBG-21688 and ENSG00000125657 and 8744, tumor necrosis factor receptor superfamily binding, Extracellular, Tnfsf9 and IDBG-193693 and ENSMUSG00000035678 and 21950, TNFSF9 and IDBG-643947 and ENSBTAG00000046266 and 521748
Gene info
Gene info
  • Identity
  • Gene
  • Long gene name
    TNF receptor superfamily member 9
  • Synonyms gene
  • Synonyms gene name
    • tumor necrosis factor receptor superfamily, member 9
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    1996-06-12
  • Entrez gene record
  • Pubmed identfication
  • Classification
    • Tumor necrosis factor receptor superfamily
    • CD molecules
  • VEGA ID
Gene info
Gene info
  • Identity
  • Gene
  • Long gene name
    piwi-interacting RNA cluster 18
  • Locus
    4
  • Discovery year
    2009-11-05
  • Entrez gene record
  • Pubmed identfication
  • Classification
    • Piwi-interacting RNA clusters
Gene info
  • Identity
  • Gene
  • Long gene name
    piwi-interacting RNA cluster 16
  • Locus
    4
  • Discovery year
    2009-11-05
  • Entrez gene record
  • Pubmed identfication
  • Classification
    • Piwi-interacting RNA clusters
Gene info
Gene info
Gene info
  • Identity
  • Gene
  • Long gene name
    immunoglobulin kappa variable 2/OR2-4 (pseudogene)
  • Synonyms gene name
    • immunoglobulin kappa variable 2/OR2-4
    • immunoglobulin kappa variable 2/OR2-4 pseudogene
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    2000-04-18
  • Entrez gene record
  • Pubmed identfication
  • Classification
    • Immunoglobulin kappa (IGK) orphons
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee