Recombinant E. coli RNA Pyrophosphohydrolase/rppH

• Catalog number
  CM26-10
• Price
  Please ask
• Size
  10 ug

• Description
  Recombinant E.coli RNA pyrophosphohydrolase is produced by our E.coli expression system and the target gene encoding Met1-Gly176 is expressed.
• Species reactivity
  E.coli
• Origin
  Escherichia coli
• Peptide sequence
  MIDDDGYRPNVGIVICNRQGQVMWARRFGQHSWQFPQGGINPGESAEQAMYRELFEEVGLSRKDVRILASTRNWLRYKLPKRLVRWDTKPVCIGQKQKWFLLQLVSGDAEINMQTSSTPEFDGWRWVSYWYPVRQVVSFKRDVYRRVMKEFASVVMSLQENTPKPQNASAYRRKRG
• Estimated molecular weight
  20,8 kDa
• Protein purity
  Greater than 95% as determined by reducing SDS-PAGE.
• Endotoxin level
  Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Shipping condition
  Dry ice/ice packs
• Package form
  Supplied as a 0.2 µm filtered solution of 50mM Tris, 500mM NaCl, 10% glycerol, pH8.0.
• Storage conditions
  Store at below -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
• Reconstitution conditions
  Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
• UniProt number
  P0A776
• Other related products
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  RNA   Pyrophosphohydrolase/rppH  
• Short name
  Recombinant RNA Pyrophosphohydrolase/rppH
• Technique
  Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture. RNAs are to store at -70 C
• Host
  e. coli, Escherichia coli, Recombination of bioactive proteins and longer peptides in Escherichia Coli is done often with His tagging. novo supplies Rec. E. Coli affinity purified or tag purified antigens in 1 quantities or bulk volumes on request.
• Species
  E. coli, E. coli
• Alternative name
  E.coli RNA pyrophosphohydrolase/rppH
• Alternative technique
  rec, escherichia

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products