Recombinant Cynomolgus Fibroblast Growth Factor 21/FGF-21 (C-6His)

  • Catalog number
    CS24-1000
  • Price
    Please ask
  • Size
    1 mg
  • Description
    Recombinant Cynomolgus Fibroblast Growth Factor 21 is produced by our Mammalian expression system and the target gene encoding His29-Ser209 is expressed with a 6His tag at the C-terminus.
  • Species reactivity
    Cynomolgus monkey/Cynomolgus monkey
  • Origin
    Human Cells
  • Peptide sequence
    HPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAAHQSPESLLQLKALKPGVIQILGVKTSRFLCQKPDGALYGSLHFDPEACSFRELLLENGYNVYQSEAHGLPLHLPGNKSPHRDPASQGPARFLPLPGLPPAPPEPPGILAPQPPDVGSSDPLSMVGPSQARSPSYASHHHHHH
  • Estimated molecular weight
    20,2 kDa
  • Protein purity
    Greater than 95% as determined by reducing SDS-PAGE.
  • Endotoxin level
    Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
  • Shipping condition
    Ambient/Room Temperature
  • Package form
    Lyophilized from a 0.2 µm filtered solution of PBS, pH7.4.
  • Storage conditions
    Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at below -20°C for 3 months.
  • Reconstitution conditions
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
  • UniProt number
    XM_005589811.2
  • Additional description
    Aplha, transcription related growth factors and stimulating factors or repressing nuclear factors are complex subunits of proteins involved in cell differentiation. Complex subunit associated factors are involved in hybridoma growth, Eosinohils, eritroid proliferation and derived from promotor binding stimulating subunits on the DNA binding complex. NFKB 105 subunit for example is a polypetide gene enhancer of genes in B cells.
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Gene symbol
    FGF21, PIRC105, SNORD115-21, HTOR, FGF18, SNORD116-21, SNORD114-21, FGF17
  • Short name
    Recombinant Cynomolgus Fibroblast Growth Factor 21/FGF-21 (C-6His)
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Alternative name
    Recombinant Cynomolgus FGF-21(C-6His)
  • Alternative technique
    rec
Gene info
Gene info
  • Identity
  • Gene
  • Long gene name
    piwi-interacting RNA cluster 105
  • Locus
    21
  • Discovery year
    2009-11-05
  • Entrez gene record
  • Pubmed identfication
  • Classification
    • Piwi-interacting RNA clusters
Gene info
Gene info
  • Identity
  • Gene
  • Long gene name
    5-hydroxytryptamine (serotonin) oxygenase regulator
  • Locus
    21
  • Discovery year
    2001-06-22
  • Entrez gene record
  • Pubmed identfication
Gene info
Gene info
Gene info
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee