Mouse anti Integrin alpha 3B

  • Catalog number
    MUB0902S
  • Price
    Please ask
  • Size
    1 mL
  • Category
    Primary Antibodies
  • Long description
    Integrins are a family of heterodimeric membrane glycoproteins consisting of non-covalently associated α and β subunits. More than 18 α and 8 β subunits with numerous splice variant isoforms have been identified in mammals. In general, integrins function as receptors for extracellular matrix proteins. Certain integrins can also bind to soluble ligands or to counter-receptors on adjacent cells, such as the intracellular adhesion molecules (ICAMs), resulting in aggregation of cells. Signals transduced by integrins play a role in many biological processes, including cell growth, differentiation, migRation and apoptosis. For integrin subunits α3 and α6, two cytoplasmic variants, A and B, have been identified.
  • Antibody come from
    54B3 is a Mouse monoclonal IgG1 antibody derived by fusion of SP2/0 Mouse myeloma cells with spleen cells from a BALB/c Mouse immunized with a synthetic peptide corresponding to a 32 amino acid stretch in the cytoplasmic domain of integrin α3B including an appending N-terminal cysteine (CTRYYQIMPKYHAVRIREEERYPPPGSTLPTKK) coupled to keyhole limpet hemocyanin.
  • Other description
    Each vial contains 1ml of culture supernatant of monoclonal antibody containing 0.09% sodium azide.
  • Clone
    54B3
  • Antigen antibody binding interaction
    Mouse anti Integrin alpha 3B Antibody
  • Antibody is raised in
    Mouse
  • Antibody s reacts with
    Human
  • Antibody s reacts with these species
    A broad species reactivity is expected because of the conserved nature of the epitope.
  • Antibody s specificity
    54B3 recognizes specifically the cytoplasmic domain of integrin subunit α3B which is present in microvascular structures in brain and heart.
  • Research interest
    Cancer,Cell adhesion
  • Application
    Immunocytochemistry,Immunohistochemistry (frozen),Western blotting
  • Antibody s suited for
    54B3 is suitable for immunoblotting, immunocytochemistry and immunohistochemistry on frozen tissues. Optimal antibody dilution should be determined by titration; recommended range is 1:2 – 1:20 for immunohistochemistry with avidin-biotinylated Horseradish peroxidase complex (ABC) as detection reagent, and 1:5 – 1:100 for immunoblotting applications.
  • Storage
    Store at 4°C, or in small aliquots at -20°C.
  • Relevant references
    de Melker, AA, Sterk, LM, Delwel, GO, Fles, D. L., Daams, H., Weening, J. J., and Sonnenberg, A. (1997). The A and B variants of the alpha 3 integrin subunit: tissue distribution and functional characterization, Lab Invest 76, 547-63.
  • Protein number
    see ncbi
  • Warnings
    This product is intended FOR RESEARCH USE ONLY, and FOR TESTS IN VITRO, not for use in diagnostic or therapeutic procedures involving humans or animals. This product contains sodium azide. To prevent formation of toxic vapors, do not mix with strong acidic solutions. To prevent formation of potentially explosive metallic azides in metal plumbing, always wash into drain with copious quantities of water. This datasheet is as accurate as reasonably achievable, but Nordic-MUbio accepts no liability for any inaccuracies or omissions in this information.
  • Description
    The Mouse anti Integrin alpha 3B is a α- or alpha protein sometimes glycoprotein present in blood. This antibody needs to be stored at + 4°C in a fridge short term in a concentrated dilution. Freeze thaw will destroy a percentage in every cycle and should be avoided.
  • Test
    Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain.
  • Latin name
    Mus musculus
  • Gene target
    Integrin   alpha  
  • Short name
    Mouse anti Integrin alpha 3B
  • Technique
    Mouse, anti, antibody to, mouses
  • Host
    mouse
  • Isotype
    IgG1
  • Label
    unlabeled
  • Species
    Mouse, Mouses
  • Alternative name
    Mouse antibody to Integrin a 3B
  • Alternative technique
    murine, antibodies
MeSH Data
  • Name
  • Concept
    Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
  • Tree numbers
    • E05.196.401.143
    • E05.301.300.096
    • E05.478.566.320.200
    • E05.601.262
    • E05.601.470.320.200
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee