ZP1 Antibody / Zona pellucida sperm-binding protein 1

• Catalog number
  R32398
• Price
  Please ask
• Size
  0.1mg

• Category
  Antibody
• Concentration
  0.5mg/ml if reconstituted with 0.2ml sterile DI water
• Form
  Antigen affinity purified
• Conjugation
  Unconjugated
• Clone
  Polyclonal antibody
• Recognised antigen
  ZP1 / Zona pellucida sperm-binding protein 1
• Host animal
  Rabbit (Oryctolagus cuniculus)
• Clonality
  Polyclonal (rabbit origin)
• Species reactivity
  Human (Homo sapiens), Rat ; Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur.
• Tested applications
  WB
• Recommended dilutions
  Western blot: 0.1-0.5ug/ml
• Notes
  Optimal dilution of the ZP1 antibody should be determined by the researcher.
• Intented use
  This ZP1 antibodyis to be used only for research purposes and not for diagnostics..
• Uniprot
  P60852
• Purity
  Antigen affinity
• Description
  Zona pellucida sperm-binding protein 1 is a protein that belopngs to the mammalian zona pellucida. The zona pellucida is an extracellular matrix that surrounds the oocyte and early embryo. It is composed primarily of three or four glycoproteins with various functions during fertilization and preimplantation development. Zp1 ensures the structural integrity of the zona pellucida. Mutations in this gene are a cause of oocyte maturation defect and infertility. And this gene is mapped to chromosome 11q12.2.
• Immunogen
  Amino acids HVLEKDGRFHLRVFMEAVLPNGRVDVAQDATLICPKPD were used as the immunogen for the ZP1 antibody.
• Storage
  After reconstitution, the ZP1 antibody may be kept for up to one month refrigerated at +4 degrees C.For long-term, aliquot and store at -20 deg. Celcius or lower. Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity. Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized. Avoid repeated freezing and thawing.
• Properties
  If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  ZP1   Zona   pellucida   sperm-binding   protein  
• Gene symbol
  ZP1
• Short name
  Anti-ZP1 / Zona pellucida sperm-binding protein 1
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Isotype
  Rabbit IgG
• Alternative name
  Antibodies to ZP1 / Zona pellucida sperm-binding protein 1
• Alternative technique
  antibodies

Gene info

• Identity
  HGNC:13187
• Gene
  ZP1
• Long gene name
  zona pellucida glycoprotein 1
• Synonyms gene name
  • zona pellucida glycoprotein 1 (sperm receptor)
• GenBank acession
  • BC067899
• Locus
  11q12.2
• Discovery year
  1999-12-10
• Entrez gene record
  22917
• Pubmed identfication
  • 10542331
• RefSeq identity
  • NM_207341
• Classification
  • Zona pellucida glycoproteins
• VEGA ID
  OTTHUMG00000167797

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products