TRIF Antibody / TICAM1
-
Catalog numberR32274
-
PricePlease ask
-
Size0.1mg
-
-
CategoryAntibody
-
Concentration0.5mg/ml if reconstituted with 0.2ml sterile DI water
-
FormAntigen affinity purified
-
ConjugationUnconjugated
-
ClonePolyclonal antibody
-
Recognised antigenTRIF / TICAM1
-
Host animalRabbit (Oryctolagus cuniculus)
-
ClonalityPolyclonal (rabbit origin)
-
Species reactivityMouse (Mus musculus) ; Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur.
-
Tested applicationsWB
-
Recommended dilutionsWestern blot: 0.1-0.5ug/ml
-
NotesOptimal dilution of the TRIF antibody should be determined by the researcher.
-
Intented useThis TRIF antibodyis to be used only for research purposes and not for diagnostics..
-
UniprotQ80UF7
-
PurityAntigen affinity
-
DescriptionTICAM1 (TIR domain containing adaptor molecule 1), also known as TRIF, is an adapter in responding to activation of toll-like receptors (TLRs). It mediates the rather delayed cascade of two TLR-associated signaling cascades, where the other one is dependent upon a MyD88 adapter. By genomic sequence analysis, Oshiumi et al. (2003) mapped the TICAM1 gene to chromosome 19p13.3. By coimmunoprecipitation analysis, Oshiumi et al. (2003) showed that TICAM1 interacts specifically with TLR3, but not with other TLRs. Functional analysis showed that the association of TLR3 and TICAM1 mediates dsRNA activation of IFNB, through NFKB, AP1, or IRF3. TICAM1 activation of NFKB was found to occur predominantly through IRAK1 rather than IRAK2. Small interfering (si)RNA blockage of TICAM1, just upstream of the TIR domain, reduced IFNB production in response to dsRNA.
-
ImmunogenAmino acids QDTEARVSLESLKMNTVAQLVAHQWADMETTE of mouse TRIF were used as the immunogen for the TRIF antibody.
-
StorageAfter reconstitution, the TRIF antibody may be kept for up to one month refrigerated at +4 degrees C.For long-term, aliquot and store at -20 deg. Celcius or lower. Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity. Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized. Avoid repeated freezing and thawing.
-
PropertiesIf you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
French translationanticorps
-
Gene target
-
Gene symbolTICAM1, TRIM69
-
Short nameAnti-TRIF / TICAM1
-
TechniqueAntibody, antibodies against human proteins, antibodies for
-
IsotypeRabbit IgG
-
Alternative nameAntibodies to TRIF / TICAM1
-
Alternative techniqueantibodies
-
Alternative to gene targettoll-like receptor adaptor molecule 1, TICAM1 and IDBG-19505 and ENSG00000127666 and 148022, protein kinase binding, Cytoplasm, Ticam1 and IDBG-191912 and ENSMUSG00000047123 and 106759, BT.47460 and IDBG-644220 and ENSBTAG00000019966 and 510427
-
Gene info
-
Identity
-
Gene
-
Long gene nametoll like receptor adaptor molecule 1
-
Synonyms gene name
- toll-like receptor adaptor molecule 1
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year2005-06-27
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- TIR domain containing
-
VEGA ID
-
Locus Specific Databases
Gene info
-
Identity
-
Gene
-
Long gene nametripartite motif containing 69
-
Synonyms gene
-
Synonyms gene name
- ring finger protein 36
- tripartite motif-containing 69
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year2002-01-10
-
Classification
- Ring finger proteins
- Tripartite motif containing
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data