TRIF Antibody / TICAM1

  • Catalog number
    R32274
  • Price
    Please ask
  • Size
    0.1mg
  • Category
    Antibody
  • Concentration
    0.5mg/ml if reconstituted with 0.2ml sterile DI water
  • Form
    Antigen affinity purified
  • Conjugation
    Unconjugated
  • Clone
    Polyclonal antibody
  • Recognised antigen
    TRIF / TICAM1
  • Host animal
    Rabbit (Oryctolagus cuniculus)
  • Clonality
    Polyclonal (rabbit origin)
  • Species reactivity
    Mouse (Mus musculus) ; Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur.
  • Tested applications
    WB
  • Recommended dilutions
    Western blot: 0.1-0.5ug/ml
  • Notes
    Optimal dilution of the TRIF antibody should be determined by the researcher.
  • Intented use
    This TRIF antibodyis to be used only for research purposes and not for diagnostics..
  • Uniprot
    Q80UF7
  • Purity
    Antigen affinity
  • Description
    TICAM1 (TIR domain containing adaptor molecule 1), also known as TRIF, is an adapter in responding to activation of toll-like receptors (TLRs). It mediates the rather delayed cascade of two TLR-associated signaling cascades, where the other one is dependent upon a MyD88 adapter. By genomic sequence analysis, Oshiumi et al. (2003) mapped the TICAM1 gene to chromosome 19p13.3. By coimmunoprecipitation analysis, Oshiumi et al. (2003) showed that TICAM1 interacts specifically with TLR3, but not with other TLRs. Functional analysis showed that the association of TLR3 and TICAM1 mediates dsRNA activation of IFNB, through NFKB, AP1, or IRF3. TICAM1 activation of NFKB was found to occur predominantly through IRAK1 rather than IRAK2. Small interfering (si)RNA blockage of TICAM1, just upstream of the TIR domain, reduced IFNB production in response to dsRNA.
  • Immunogen
    Amino acids QDTEARVSLESLKMNTVAQLVAHQWADMETTE of mouse TRIF were used as the immunogen for the TRIF antibody.
  • Storage
    After reconstitution, the TRIF antibody may be kept for up to one month refrigerated at +4 degrees C.For long-term, aliquot and store at -20 deg. Celcius or lower. Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity. Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized. Avoid repeated freezing and thawing.
  • Properties
    If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
  • French translation
    anticorps
  • Gene target
    TRIF   TICAM1  
  • Gene symbol
    TICAM1, TRIM69
  • Short name
    Anti-TRIF / TICAM1
  • Technique
    Antibody, antibodies against human proteins, antibodies for
  • Isotype
    Rabbit IgG
  • Alternative name
    Antibodies to TRIF / TICAM1
  • Alternative technique
    antibodies
  • Alternative to gene target
    toll-like receptor adaptor molecule 1, TICAM1 and IDBG-19505 and ENSG00000127666 and 148022, protein kinase binding, Cytoplasm, Ticam1 and IDBG-191912 and ENSMUSG00000047123 and 106759, BT.47460 and IDBG-644220 and ENSBTAG00000019966 and 510427
Gene info
Gene info
  • Identity
  • Gene
  • Long gene name
    tripartite motif containing 69
  • Synonyms gene
  • Synonyms gene name
    • ring finger protein 36
    • tripartite motif-containing 69
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    2002-01-10
  • Classification
    • Ring finger proteins
    • Tripartite motif containing
  • VEGA ID
MeSH Data
  • Name
  • Concept
    Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
  • Tree numbers
    • E05.196.401.143
    • E05.301.300.096
    • E05.478.566.320.200
    • E05.601.262
    • E05.601.470.320.200
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee