TIP47 Antibody / Perilipin 3 / M6PRBP1

• Catalog number
  R32450
• Price
  Please ask
• Size
  0.1mg

• Category
  Antibody
• Concentration
  0.5mg/ml if reconstituted with 0.2ml sterile DI water
• Form
  Antigen affinity purified
• Conjugation
  Unconjugated
• Clone
  Polyclonal antibody
• Recognised antigen
  TIP47 / Perilipin 3 / M6PRBP1
• Host animal
  Rabbit (Oryctolagus cuniculus)
• Clonality
  Polyclonal (rabbit origin)
• Species reactivity
  Human (Homo sapiens), Mouse (Mus musculus), Rat ; Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur.
• Tested applications
  WB, IHC-P
• Recommended dilutions
  Western blot: 0.5-1ug/ml,IHC (FFPE): 1-2ug/ml
• Added buffer
  Lyophilized from 1X Phosphate Buffered Saline (PBS) with 2.5% BSA and 0.025% sodium azide
• Intented use
  This Perilipin 3 antibodyis to be used only for research purposes and not for diagnostics..
• Uniprot
  O60664
• Purity
  Antigen affinity
• Description
  Mannose-6-phosphate receptor binding protein 1 (M6PRBP1), also known as Perilipin 3 (PLN3) or TIP47, is a protein which in humans is encoded by the M6PRBP1 gene. Mannose 6-phophate receptors (MPRs) deliver lysosomal hydrolase from the Golgi to endosomes and then return to the Golgi complex. The protein encoded by this gene interacts with the cytoplasmic domains of both cation-independent and cation-dependent MPRs, and is required for endosome-to-Golgi transport. This protein also binds directly to the GTPase RAB9 (RAB9A), a member of the RAS oncogene family. The interaction with RAB9 has been shown to increase the affinity of this protein for its cargo. Multiple transcript variants encoding different isoforms have been found for this gene.
• Immunogen
  Amino acids ESRALTMFRDIAQQLQATCTSLGSSIQGLPTNVKDQVQQARRQ were used as the immunogen for the Perilipin 3 antibody.
• Storage
  Prior to reconstitution, store at 4oC. After reconstitution, the Perilipin 3 antibody may be kept for up to one month refrigerated at +4 degrees C.For long-term, aliquot and store at -20 deg. Celcius or lower. Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity. Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized. Avoid repeated freezing and thawing.
• Localization
  Cytoplasmic, membranous
• Properties
  If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  TIP47   Perilipin   M6PRBP1  
• Gene symbol
  PLIN3
• Short name
  Anti- TIP47 / Perilipin 3 / M6PRBP1
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Isotype
  Rabbit IgG
• Alternative name
  Antibodies to TIP47 / Perilipin 3 / M6PRBP1
• Alternative technique
  antibodies

Gene info

• Identity
  HGNC:16893
• Gene
  PLIN3
• Long gene name
  perilipin 3
• Synonyms gene
  • M6PRBP1
• Synonyms gene name
  • mannose-6-phosphate receptor binding protein 1
• Synonyms
  • TIP47
  • PP17
• Synonyms name
  • cargo selection protein (mannose 6 phosphate receptor binding protein)
  • placental protein 17
  • MPR-BINDING PROTEIN, 47-KD
• GenBank acession
  • AF051314
• Locus
  19p13.3
• Discovery year
  2004-01-16
• Entrez gene record
  10226
• Pubmed identfication
  • 9590177
  • 6856484
  • 19638644
• RefSeq identity
  • NM_005817
• Classification
  • Perilipins
• VEGA ID
  OTTHUMG00000180249

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products