SPARC Antibody

• Catalog number
  R31925
• Price
  Please ask
• Size
  0.1mg

• Category
  Antibody
• Concentration
  0.5mg/ml if reconstituted with 0.2ml sterile DI water
• Form
  Antigen affinity purified
• Conjugation
  Unconjugated
• Clone
  Polyclonal antibody
• Recognised antigen
  SPARC
• Host animal
  Rabbit (Oryctolagus cuniculus)
• Clonality
  Polyclonal (rabbit origin)
• Species reactivity
  Human (Homo sapiens) ; Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur.
• Tested applications
  WB
• Recommended dilutions
  Western blot: 0.1-0.5ug/ml
• Notes
  Optimal dilution of the SPARC antibody should be determined by the researcher.
• Intented use
  This SPARC antibodyis to be used only for research purposes and not for diagnostics..
• Uniprot
  P09486
• Purity
  Antigen affinity
• Description
  SPARC, secreted protein acidic and rich in cysteine , also known as Osteonectin is a protein that in humans is encoded by the SPARC gene. The human SPARC gene is 26.5 kb long, and contains 10 exons and 9 introns and is located on chromosome 5q31-q33. SPARC is a glycoprotein of ~40 kDa. SPARC is an acidic, cysteine-rich glycoprotein consisting of a single polypeptide chain that can be broken into 4 domains: 1) an Ca++ binding domains near the glutamic acidic-rich region at the amino terminus (domain I), 2) a cysteine- rich (domain II), 3) a hydrophilic region (domain III) and 4) an EF hand motif at the carboxy terminus region (domain IV). Osteonectin is a glycoprotein in the bone that binds sodium. It is secreted by osteoblasts during bone formation, initiating mineralization and promoting mineral crystal formation. Osteonectin also shows affinity for collagen in addition to bone mineral calcium. A correlation between osteonectin over expression and ampullary cancers and chronic pancreatitis has been found.
• Immunogen
  Amino acids RFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLVI of human SPARC were used as the immunogen for the SPARC antibody.
• Storage
  After reconstitution, the SPARC antibody may be kept for up to one month refrigerated at +4 degrees C.For long-term, aliquot and store at -20 deg. Celcius or lower. Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity. Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized. Avoid repeated freezing and thawing.
• Properties
  If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  SPARC  
• Gene symbol
  CLMAT3, SPARC
• Short name
  Anti-SPARC
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Isotype
  Rabbit IgG
• Alternative name
  Antibodies to SPARC
• Alternative technique
  antibodies
• Alternative to gene target
  secreted protein, acidic, cysteine-rich (osteonectin), ON, SPARC and IDBG-54562 and ENSG00000113140 and 6678, extracellular matrix binding, nuclei, Sparc and IDBG-175174 and ENSMUSG00000018593 and 20692, SPARC and IDBG-646341 and ENSBTAG00000014835 and 282077

Gene info

• Identity
  HGNC:52287
• Gene
  CLMAT3
• Long gene name
  colorectal liver metastasis associated transcript 3
• Synonyms
  • SPARC-AS1
• Synonyms name
  • SPARC antisense RNA 1
• Locus
  5q33.1
• Discovery year
  2017-06-15
• Entrez gene record
  101927096
• Pubmed identfication
  • 26050227
• RefSeq identity
  • NR_109873
• Classification
  • Long non-coding RNAs with non-systematic symbols

Gene info

• Identity
  HGNC:11219
• Gene
  SPARC
• Long gene name
  secreted protein acidic and cysteine rich
• Synonyms gene
  • ON
• Synonyms gene name
  • osteonectin
• Synonyms
  • ONT
  • BM-40
• Synonyms name
  • cysteine-rich protein
  • secreted protein acidic and rich in cysteine
• Locus
  5q33.1
• Discovery year
  2001-06-22
• Entrez gene record
  6678
• Pubmed identfication
  • 2838412
  • 3410046
• RefSeq identity
  • NM_003118
• Classification
  • SPARC family
• VEGA ID
  OTTHUMG00000130122

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products