SHP2 Antibody
-
Catalog numberR32193
-
PricePlease ask
-
Size0.1mg
-
-
CategoryAntibody
-
Concentration0.5mg/ml if reconstituted with 0.2ml sterile DI water
-
FormAntigen affinity purified
-
ConjugationUnconjugated
-
ClonePolyclonal antibody
-
Recognised antigenSHP2
-
Host animalRabbit (Oryctolagus cuniculus)
-
ClonalityPolyclonal (rabbit origin)
-
Species reactivityHuman (Homo sapiens), Mouse (Mus musculus), Rat ; Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur.
-
Tested applicationsWB, IHC-P
-
Recommended dilutionsWestern blot: 0.1-0.5ug/ml,IHC (Paraffin): 0.5-1ug/ml
-
NotesOptimal dilution of the SHP-2 antibody should be determined by the researcher.
-
Intented useThis SHP-2 antibodyis to be used only for research purposes and not for diagnostics..
-
UniprotQ06124
-
PurityAntigen affinity
-
DescriptionPTPN11 (Tyrosine-protein phosphatase non-receptor type 11), also known as protein-tyrosine phosphatase 1D (PTP-1D), protein-tyrosine phosphatase 2C (PTP-2C), TYROSINE PHOSPHATASE SHP2 (SHP2), BPTP3, SH-PTP2, SHP-2, SH-PTP3, is an enzyme that in humans is encoded by the PTPN11 gene. PTPN11 is a member of the protein tyrosine phosphatase (PTP) family. The open reading frame consists of 1,779 nucleotides potentially encoding a protein of 593 amino acids with a predicted molecular mass of 68 kD. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP contains two tandem Src homology-2 domains, which function as phospho-tyrosine binding domains and mediate the interaction of this PTP with its substrates. This PTP is widely expressed in most tissues and plays a regulatory role in various cell signaling events that are important for a diversity of cell functions, such as mitogenic activation, metabolic control, transcription regulation, and cell migration. Mutations in this gene are a cause of Noonan syndrome as well as acute myeloid leukemia.
-
ImmunogenAmino acids EKFATLAELVQYYMEHHGQLKEKNGDVIELK of human SHP2/PTPN11 were used as the immunogen for the SHP-2 antibody.
-
StorageAfter reconstitution, the SHP-2 antibody may be kept for up to one month refrigerated at +4 degrees C.For long-term, aliquot and store at -20 deg. Celcius or lower. Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity. Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized. Avoid repeated freezing and thawing.
-
PropertiesIf you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
French translationanticorps
-
Gene target
-
Gene symbolPTPN11
-
Short nameAnti-SHP2
-
TechniqueAntibody, antibodies against human proteins, antibodies for
-
IsotypeRabbit IgG
-
Alternative nameAntibodies to SHP2
-
Alternative techniqueantibodies
-
Gene info
-
Identity
-
Gene
-
Long gene nameprotein tyrosine phosphatase non-receptor type 11
-
Synonyms gene
-
Synonyms gene name
- Noonan syndrome 1
- protein tyrosine phosphatase, non-receptor type 11
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year1993-03-03
-
Entrez gene record
-
Pubmed identfication
-
Classification
- Protein tyrosine phosphatases non-receptor type
- SH2 domain containing
-
VEGA ID
-
Locus Specific Databases
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data