RPA70 Antibody / RPA1
-
Catalog numberR32042
-
PricePlease ask
-
Size0.1mg
-
-
CategoryAntibody
-
Concentration0.5mg/ml if reconstituted with 0.2ml sterile DI water
-
FormAntigen affinity purified
-
ConjugationUnconjugated
-
ClonePolyclonal antibody
-
Recognised antigenRPA70 / RPA1
-
Host animalRabbit (Oryctolagus cuniculus)
-
ClonalityPolyclonal (rabbit origin)
-
Species reactivityHuman (Homo sapiens) ; Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur.
-
Tested applicationsWB
-
Recommended dilutionsWestern blot: 0.1-0.5ug/ml
-
NotesOptimal dilution of the RPA1 antibody should be determined by the researcher.
-
Intented useThis RPA1 antibodyis to be used only for research purposes and not for diagnostics..
-
UniprotP27694
-
PurityAntigen affinity
-
DescriptionReplication protein A 70 kDa DNA-binding subunit is a protein that in humans is encoded by the RPA1 gene. This gene is mapped to chromosome 17p13.3. Replication protein A (RPA) is a heterotrimeric single-strand DNA (ssDNA)-binding protein essential for DNA replication, repair, and recombination. It is composed of 70-kD (RPA1), 32-kD (RPA2), and 14-kD (RPA3) subunits. The RPA1 subunit is responsible for high-affinity ssDNA binding. The RPA complex was originally isolated as a factor essential for in vitro replication of the papovavirus SV40. It had been found that recombinant human RPA1, purified from bacteria, exhibited ssDNA-binding activity comparable to that of the complete RPA complex. RPA1 could substitute for the complete complex in stimulating the activity of DNA polymerase alpha-primase, but it could not substitute for the complete complex in SV40 DNA replication in vitro, suggesting an important functional role for the other subunits.
-
ImmunogenAmino acids QESAEAILGQNAAYLGELKDKNEQAFEEVFQNANFR of human RPA1 were used as the immunogen for the RPA1 antibody.
-
StorageAfter reconstitution, the RPA1 antibody may be kept for up to one month refrigerated at +4 degrees C.For long-term, aliquot and store at -20 deg. Celcius or lower. Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity. Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized. Avoid repeated freezing and thawing.
-
PropertiesIf you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
French translationanticorps
-
Gene target
-
Gene symbolRPA1, POLR1A
-
Short nameAnti-RPA70 / RPA1
-
TechniqueAntibody, antibodies against human proteins, antibodies for
-
IsotypeRabbit IgG
-
Alternative nameAntibodies to RPA70 / RPA1
-
Alternative techniqueantibodies
-
Gene info
-
Identity
-
Gene
-
Long gene namereplication protein A1
-
Synonyms gene name
- replication protein A1 (70kD)
- replication protein A1, 70kDa
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year1993-12-14
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Nucleotide excision repair
-
VEGA ID
Gene info
-
Identity
-
Gene
-
Long gene nameRNA polymerase I subunit A
-
Synonyms gene name
- polymerase (RNA) I polypeptide A, 194kDa
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year2003-04-01
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- RNA polymerase subunits
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
